BLASTX nr result
ID: Forsythia22_contig00055822
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00055822 (274 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007208391.1| hypothetical protein PRUPE_ppa000282mg [Prun... 56 8e-08 ref|XP_008388316.1| PREDICTED: regulatory-associated protein of ... 55 1e-07 ref|XP_010091104.1| Regulatory-associated protein of TOR 1 [Moru... 54 3e-07 ref|XP_002533827.1| Regulatory-associated protein of mTOR, putat... 54 3e-07 ref|XP_002531312.1| conserved hypothetical protein [Ricinus comm... 54 3e-07 ref|XP_003632587.1| PREDICTED: regulatory-associated protein of ... 54 5e-07 ref|XP_003533671.1| PREDICTED: regulatory-associated protein of ... 53 6e-07 ref|XP_007140148.1| hypothetical protein PHAVU_008G087800g [Phas... 53 6e-07 ref|XP_012089724.1| PREDICTED: regulatory-associated protein of ... 53 6e-07 gb|KDP22798.1| hypothetical protein JCGZ_00385 [Jatropha curcas] 53 6e-07 ref|XP_012089725.1| PREDICTED: regulatory-associated protein of ... 53 6e-07 gb|KHN40662.1| Regulatory-associated protein of TOR 1 [Glycine s... 53 6e-07 ref|XP_002309174.1| transducin family protein [Populus trichocar... 54 8e-07 ref|XP_009623806.1| PREDICTED: regulatory-associated protein of ... 53 8e-07 ref|XP_003551595.1| PREDICTED: regulatory-associated protein of ... 53 8e-07 ref|XP_006602692.1| PREDICTED: regulatory-associated protein of ... 53 8e-07 ref|XP_009623808.1| PREDICTED: regulatory-associated protein of ... 53 8e-07 ref|XP_006602693.1| PREDICTED: regulatory-associated protein of ... 53 8e-07 ref|XP_009623809.1| PREDICTED: regulatory-associated protein of ... 53 8e-07 ref|XP_009800404.1| PREDICTED: regulatory-associated protein of ... 53 8e-07 >ref|XP_007208391.1| hypothetical protein PRUPE_ppa000282mg [Prunus persica] gi|462404033|gb|EMJ09590.1| hypothetical protein PRUPE_ppa000282mg [Prunus persica] Length = 1346 Score = 56.2 bits (134), Expect(2) = 8e-08 Identities = 26/38 (68%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LHDW SSS STRDCIL+AACE+HE QSA FP Sbjct: 251 FIELHDWGGSSSSGSTRDCILLAACEAHETLPQSAEFP 288 Score = 26.6 bits (57), Expect(2) = 8e-08 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 291 VFTSCLTTPIKMALR 305 >ref|XP_008388316.1| PREDICTED: regulatory-associated protein of TOR 1-like [Malus domestica] Length = 1348 Score = 55.5 bits (132), Expect(2) = 1e-07 Identities = 25/38 (65%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LHDW +SSS S RDCIL+AACE+HE QSA FP Sbjct: 251 FIELHDWGSSSSSGSARDCILLAACEAHETLPQSAEFP 288 Score = 26.6 bits (57), Expect(2) = 1e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 291 VFTSCLTTPIKMALR 305 >ref|XP_010091104.1| Regulatory-associated protein of TOR 1 [Morus notabilis] gi|587852264|gb|EXB42394.1| Regulatory-associated protein of TOR 1 [Morus notabilis] Length = 1345 Score = 54.3 bits (129), Expect(2) = 3e-07 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LH+W SS+ STRDCIL+AACE+HE QSA FP Sbjct: 255 FIELHEWGASSTSGSTRDCILLAACEAHETLPQSAEFP 292 Score = 26.6 bits (57), Expect(2) = 3e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 295 VFTSCLTTPIKMALR 309 >ref|XP_002533827.1| Regulatory-associated protein of mTOR, putative [Ricinus communis] gi|223526244|gb|EEF28562.1| Regulatory-associated protein of mTOR, putative [Ricinus communis] Length = 1221 Score = 54.3 bits (129), Expect(2) = 3e-07 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LHDW +SSS S +DCIL+AACE+HE QSA FP Sbjct: 114 FLELHDWNSSSSTGSVKDCILLAACEAHETLPQSAEFP 151 Score = 26.6 bits (57), Expect(2) = 3e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 154 VFTSCLTTPIKMALR 168 >ref|XP_002531312.1| conserved hypothetical protein [Ricinus communis] gi|223529080|gb|EEF31062.1| conserved hypothetical protein [Ricinus communis] Length = 1108 Score = 54.3 bits (129), Expect(2) = 3e-07 Identities = 24/38 (63%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LHDW +SSS S +DCIL+AACE+HE QSA FP Sbjct: 331 FLELHDWNSSSSTGSVKDCILLAACEAHETLPQSAEFP 368 Score = 26.6 bits (57), Expect(2) = 3e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 371 VFTSCLTTPIKMALR 385 >ref|XP_003632587.1| PREDICTED: regulatory-associated protein of TOR 1 [Vitis vinifera] gi|297735579|emb|CBI18073.3| unnamed protein product [Vitis vinifera] Length = 1363 Score = 53.5 bits (127), Expect(2) = 5e-07 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LHDW S S S RDCIL+AACE+HE QSA FP Sbjct: 249 FIELHDWNASVSSGSARDCILLAACEAHETLPQSAEFP 286 Score = 26.6 bits (57), Expect(2) = 5e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 289 VFTSCLTTPIKMALR 303 >ref|XP_003533671.1| PREDICTED: regulatory-associated protein of TOR 1-like [Glycine max] Length = 1373 Score = 53.1 bits (126), Expect(2) = 6e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LH+W+ S+S S RDCIL+AACE+HE QSA FP Sbjct: 274 FIELHEWSASNSSVSQRDCILLAACEAHETLPQSAEFP 311 Score = 26.6 bits (57), Expect(2) = 6e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 314 VFTSCLTTPIKMALR 328 >ref|XP_007140148.1| hypothetical protein PHAVU_008G087800g [Phaseolus vulgaris] gi|561013281|gb|ESW12142.1| hypothetical protein PHAVU_008G087800g [Phaseolus vulgaris] Length = 1370 Score = 53.1 bits (126), Expect(2) = 6e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LH+W+ S+S S RDCIL+AACE+HE QSA FP Sbjct: 267 FIELHEWSASNSSVSQRDCILLAACEAHETLPQSAEFP 304 Score = 26.6 bits (57), Expect(2) = 6e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 307 VFTSCLTTPIKMALR 321 >ref|XP_012089724.1| PREDICTED: regulatory-associated protein of TOR 1 isoform X1 [Jatropha curcas] Length = 1363 Score = 53.1 bits (126), Expect(2) = 6e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LHDW ++SS S +DCIL+AACE+HE QSA FP Sbjct: 252 FLELHDWNSTSSTGSVKDCILLAACEAHETLPQSAEFP 289 Score = 26.6 bits (57), Expect(2) = 6e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 292 VFTSCLTTPIKMALR 306 >gb|KDP22798.1| hypothetical protein JCGZ_00385 [Jatropha curcas] Length = 1357 Score = 53.1 bits (126), Expect(2) = 6e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LHDW ++SS S +DCIL+AACE+HE QSA FP Sbjct: 246 FLELHDWNSTSSTGSVKDCILLAACEAHETLPQSAEFP 283 Score = 26.6 bits (57), Expect(2) = 6e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 286 VFTSCLTTPIKMALR 300 >ref|XP_012089725.1| PREDICTED: regulatory-associated protein of TOR 1 isoform X2 [Jatropha curcas] Length = 1355 Score = 53.1 bits (126), Expect(2) = 6e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LHDW ++SS S +DCIL+AACE+HE QSA FP Sbjct: 252 FLELHDWNSTSSTGSVKDCILLAACEAHETLPQSAEFP 289 Score = 26.6 bits (57), Expect(2) = 6e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 292 VFTSCLTTPIKMALR 306 >gb|KHN40662.1| Regulatory-associated protein of TOR 1 [Glycine soja] Length = 1228 Score = 53.1 bits (126), Expect(2) = 6e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LH+W+ S+S S RDCIL+AACE+HE QSA FP Sbjct: 114 FIELHEWSASNSSVSQRDCILLAACEAHETLPQSAEFP 151 Score = 26.6 bits (57), Expect(2) = 6e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 154 VFTSCLTTPIKMALR 168 >ref|XP_002309174.1| transducin family protein [Populus trichocarpa] gi|222855150|gb|EEE92697.1| transducin family protein [Populus trichocarpa] Length = 1377 Score = 53.9 bits (128), Expect(2) = 8e-07 Identities = 24/38 (63%), Positives = 27/38 (71%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LHDW S S STRDCIL+AACE+HE QS FP Sbjct: 271 FLELHDWNASGSAGSTRDCILLAACEAHETLPQSDEFP 308 Score = 25.4 bits (54), Expect(2) = 8e-07 Identities = 10/15 (66%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMAL+ Sbjct: 311 VFTSCLTTPIKMALK 325 >ref|XP_009623806.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X1 [Nicotiana tomentosiformis] gi|697139436|ref|XP_009623807.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X1 [Nicotiana tomentosiformis] Length = 1370 Score = 52.8 bits (125), Expect(2) = 8e-07 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = -3 Query: 164 FCQLHDWTTS-SSGPSTRDCILMAACESHEIPSQSA*FP 51 F +L DWT S SSG S RDCIL+AACE+HE QSA FP Sbjct: 264 FIELQDWTASGSSGTSARDCILLAACEAHETLPQSAEFP 302 Score = 26.6 bits (57), Expect(2) = 8e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 305 VFTSCLTTPIKMALR 319 >ref|XP_003551595.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X1 [Glycine max] Length = 1365 Score = 52.8 bits (125), Expect(2) = 8e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LH+W+ S+S S RDCIL+AACE+HE QSA FP Sbjct: 266 FIELHEWSPSNSSVSQRDCILLAACEAHETLPQSAEFP 303 Score = 26.6 bits (57), Expect(2) = 8e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 306 VFTSCLTTPIKMALR 320 >ref|XP_006602692.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X2 [Glycine max] Length = 1312 Score = 52.8 bits (125), Expect(2) = 8e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LH+W+ S+S S RDCIL+AACE+HE QSA FP Sbjct: 266 FIELHEWSPSNSSVSQRDCILLAACEAHETLPQSAEFP 303 Score = 26.6 bits (57), Expect(2) = 8e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 306 VFTSCLTTPIKMALR 320 >ref|XP_009623808.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X2 [Nicotiana tomentosiformis] Length = 1280 Score = 52.8 bits (125), Expect(2) = 8e-07 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = -3 Query: 164 FCQLHDWTTS-SSGPSTRDCILMAACESHEIPSQSA*FP 51 F +L DWT S SSG S RDCIL+AACE+HE QSA FP Sbjct: 264 FIELQDWTASGSSGTSARDCILLAACEAHETLPQSAEFP 302 Score = 26.6 bits (57), Expect(2) = 8e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 305 VFTSCLTTPIKMALR 319 >ref|XP_006602693.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X3 [Glycine max] Length = 1258 Score = 52.8 bits (125), Expect(2) = 8e-07 Identities = 23/38 (60%), Positives = 29/38 (76%) Frame = -3 Query: 164 FCQLHDWTTSSSGPSTRDCILMAACESHEIPSQSA*FP 51 F +LH+W+ S+S S RDCIL+AACE+HE QSA FP Sbjct: 159 FIELHEWSPSNSSVSQRDCILLAACEAHETLPQSAEFP 196 Score = 26.6 bits (57), Expect(2) = 8e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 199 VFTSCLTTPIKMALR 213 >ref|XP_009623809.1| PREDICTED: regulatory-associated protein of TOR 1-like isoform X3 [Nicotiana tomentosiformis] Length = 1220 Score = 52.8 bits (125), Expect(2) = 8e-07 Identities = 26/39 (66%), Positives = 29/39 (74%), Gaps = 1/39 (2%) Frame = -3 Query: 164 FCQLHDWTTS-SSGPSTRDCILMAACESHEIPSQSA*FP 51 F +L DWT S SSG S RDCIL+AACE+HE QSA FP Sbjct: 114 FIELQDWTASGSSGTSARDCILLAACEAHETLPQSAEFP 152 Score = 26.6 bits (57), Expect(2) = 8e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 155 VFTSCLTTPIKMALR 169 >ref|XP_009800404.1| PREDICTED: regulatory-associated protein of TOR 1 isoform X1 [Nicotiana sylvestris] gi|698510488|ref|XP_009800405.1| PREDICTED: regulatory-associated protein of TOR 1 isoform X1 [Nicotiana sylvestris] Length = 1200 Score = 52.8 bits (125), Expect(2) = 8e-07 Identities = 27/39 (69%), Positives = 30/39 (76%), Gaps = 1/39 (2%) Frame = -3 Query: 164 FCQLHDWTTS-SSGPSTRDCILMAACESHEIPSQSA*FP 51 F +L D T S SSGPSTRDCIL+AACE+HE QSA FP Sbjct: 242 FIELQDLTVSDSSGPSTRDCILLAACEAHETLPQSAEFP 280 Score = 26.6 bits (57), Expect(2) = 8e-07 Identities = 11/15 (73%), Positives = 12/15 (80%) Frame = -2 Query: 45 IFTYCLKIPIKMALR 1 +FT CL PIKMALR Sbjct: 283 VFTSCLTTPIKMALR 297