BLASTX nr result
ID: Forsythia22_contig00055219
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00055219 (301 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011100369.1| PREDICTED: putative pentatricopeptide repeat... 65 2e-08 >ref|XP_011100369.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial [Sesamum indicum] gi|747046583|ref|XP_011100379.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial [Sesamum indicum] gi|747046585|ref|XP_011100387.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial [Sesamum indicum] gi|747046587|ref|XP_011100395.1| PREDICTED: putative pentatricopeptide repeat-containing protein At5g06400, mitochondrial [Sesamum indicum] Length = 1057 Score = 64.7 bits (156), Expect = 2e-08 Identities = 39/87 (44%), Positives = 58/87 (66%), Gaps = 3/87 (3%) Frame = -2 Query: 300 MKNLFKREFLRSTSYNNLLNNN--RSHVVQVFYFSVLSNKSSNRLQNAKNVER-AHLKNQ 130 M+ LFK L S S NN+LN++ VVQV S +S+KS +QN++ +++ + L + Sbjct: 1 MRYLFKAGVLNSNSCNNVLNSHFRAPGVVQVASHSNMSSKS---VQNSRKIDKNSDLDSP 57 Query: 129 RENMNFGPLFNEILGILGTDKLTTDEN 49 RE +FGPLFNEILGILGT+ + ++N Sbjct: 58 RELQSFGPLFNEILGILGTENIAAEKN 84