BLASTX nr result
ID: Forsythia22_contig00054542
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00054542 (310 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KFK44297.1| hypothetical protein AALP_AA1G239700 [Arabis alpina] 66 8e-09 gb|KFK44296.1| hypothetical protein AALP_AA1G239700 [Arabis alpina] 66 8e-09 gb|KFK32461.1| hypothetical protein AALP_AA6G244800 [Arabis alpina] 65 2e-08 ref|XP_008222401.1| PREDICTED: uncharacterized protein LOC103322... 65 2e-08 gb|KFK37069.1| hypothetical protein AALP_AA4G208700 [Arabis alpina] 65 2e-08 ref|XP_010690161.1| PREDICTED: uncharacterized protein LOC104903... 64 3e-08 ref|XP_009621719.1| PREDICTED: uncharacterized protein LOC104113... 64 3e-08 gb|KFK23365.1| hypothetical protein AALP_AAs72841U000200 [Arabis... 64 3e-08 ref|XP_009354581.1| PREDICTED: uncharacterized protein LOC103945... 64 4e-08 ref|XP_009379509.1| PREDICTED: uncharacterized protein LOC103967... 64 5e-08 gb|KFK24791.1| hypothetical protein AALP_AA8G025400 [Arabis alpina] 64 5e-08 gb|KFK24790.1| hypothetical protein AALP_AA8G025400 [Arabis alpina] 64 5e-08 gb|KFK23511.1| hypothetical protein AALP_AAs69829U000200 [Arabis... 63 7e-08 ref|XP_009625099.1| PREDICTED: uncharacterized protein LOC104116... 63 9e-08 gb|KFK32352.1| hypothetical protein AALP_AA6G230500 [Arabis alpina] 62 1e-07 gb|KFK32351.1| hypothetical protein AALP_AA6G230500 [Arabis alpina] 62 1e-07 ref|XP_008222771.1| PREDICTED: uncharacterized protein LOC103322... 62 1e-07 ref|XP_008229063.1| PREDICTED: uncharacterized protein LOC103328... 62 2e-07 ref|XP_008345677.1| PREDICTED: uncharacterized protein LOC103408... 61 3e-07 ref|XP_010683827.1| PREDICTED: uncharacterized protein LOC104898... 61 3e-07 >gb|KFK44297.1| hypothetical protein AALP_AA1G239700 [Arabis alpina] Length = 1374 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 VF ++ E G L NWEGPY+V + RPG Y + M K LH WNA+HL+RYY Sbjct: 1319 VFQNTAERNAGKLGANWEGPYKVTTVVRPGVYELATMAGKPILHSWNAKHLKRYY 1373 >gb|KFK44296.1| hypothetical protein AALP_AA1G239700 [Arabis alpina] Length = 1197 Score = 66.2 bits (160), Expect = 8e-09 Identities = 28/55 (50%), Positives = 35/55 (63%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 VF ++ E G L NWEGPY+V + RPG Y + M K LH WNA+HL+RYY Sbjct: 1142 VFQNTAERNAGKLGANWEGPYKVTTVVRPGVYELATMAGKPILHSWNAKHLKRYY 1196 >gb|KFK32461.1| hypothetical protein AALP_AA6G244800 [Arabis alpina] Length = 1142 Score = 65.1 bits (157), Expect = 2e-08 Identities = 28/55 (50%), Positives = 34/55 (61%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 VF +S E G L NWEGPY+V + RPG Y + M LH WNA+HL+RYY Sbjct: 1087 VFQNSAERNAGKLGANWEGPYKVTAVVRPGVYELATMAGTPILHSWNAKHLKRYY 1141 >ref|XP_008222401.1| PREDICTED: uncharacterized protein LOC103322272 [Prunus mume] Length = 760 Score = 65.1 bits (157), Expect = 2e-08 Identities = 27/56 (48%), Positives = 35/56 (62%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYYQ 170 V L++K GTL P WEGPY + RP TY++ D K HPWNA+HL+ YY+ Sbjct: 705 VSLATKNPNEGTLGPTWEGPYEITKVCRPRTYQLRDPKGKTLPHPWNADHLKYYYK 760 >gb|KFK37069.1| hypothetical protein AALP_AA4G208700 [Arabis alpina] Length = 1516 Score = 64.7 bits (156), Expect = 2e-08 Identities = 26/55 (47%), Positives = 35/55 (63%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 VF ++ E G L NWEGPY++ + RPG Y + M +K LH WN +HL+RYY Sbjct: 1461 VFQNTAERNAGKLGANWEGPYKITTVVRPGVYELTTMASKPILHSWNVKHLKRYY 1515 >ref|XP_010690161.1| PREDICTED: uncharacterized protein LOC104903745 [Beta vulgaris subsp. vulgaris] Length = 299 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/52 (55%), Positives = 34/52 (65%) Frame = +3 Query: 12 SSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 + K H GTL NWEGPY V E PG+YR+EDM KL + WNA L+RYY Sbjct: 247 TGKAHVDGTLTANWEGPYLVKEEIVPGSYRLEDMSGKLLKNSWNASVLKRYY 298 >ref|XP_009621719.1| PREDICTED: uncharacterized protein LOC104113305 [Nicotiana tomentosiformis] Length = 452 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/55 (52%), Positives = 35/55 (63%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 VF S+K GV L PNWEGPY+V T G Y +E MD K+ WNA HL++YY Sbjct: 397 VFQSTKTTGVEKLNPNWEGPYKVRGITGKGAYELETMDGKVLPSSWNAVHLKKYY 451 >gb|KFK23365.1| hypothetical protein AALP_AAs72841U000200 [Arabis alpina] Length = 732 Score = 64.3 bits (155), Expect = 3e-08 Identities = 27/55 (49%), Positives = 34/55 (61%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 VF ++ E G L NWEGPY+V + RPG Y + M K LH WN +HL+RYY Sbjct: 677 VFQNTAERNAGKLGANWEGPYKVTTVVRPGVYELATMAGKPILHSWNEKHLKRYY 731 >ref|XP_009354581.1| PREDICTED: uncharacterized protein LOC103945711 [Pyrus x bretschneideri] Length = 336 Score = 63.9 bits (154), Expect = 4e-08 Identities = 23/46 (50%), Positives = 34/46 (73%) Frame = +3 Query: 33 GTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYYQ 170 G L PNW+GP+ V+ +RPG+Y++ + D K HPWNA+HL+ YY+ Sbjct: 291 GMLSPNWDGPFEVIGISRPGSYKLRNSDGKTLGHPWNADHLKYYYK 336 >ref|XP_009379509.1| PREDICTED: uncharacterized protein LOC103967908 [Pyrus x bretschneideri] Length = 279 Score = 63.5 bits (153), Expect = 5e-08 Identities = 25/56 (44%), Positives = 36/56 (64%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYYQ 170 + L + GTL NW+GP+ V+S +RPG+Y++ D K HPWNA+HL YY+ Sbjct: 224 ILLCDRVSSEGTLSLNWDGPFEVISISRPGSYKLRSSDGKTFGHPWNADHLNYYYK 279 >gb|KFK24791.1| hypothetical protein AALP_AA8G025400 [Arabis alpina] Length = 771 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/55 (49%), Positives = 34/55 (61%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 VF ++ E G L NWEGPY+V + RP Y + M K LH WNA+HL+RYY Sbjct: 716 VFQNTAERNAGKLGANWEGPYKVTTVVRPSIYELATMAGKPILHSWNAKHLKRYY 770 >gb|KFK24790.1| hypothetical protein AALP_AA8G025400 [Arabis alpina] Length = 570 Score = 63.5 bits (153), Expect = 5e-08 Identities = 27/55 (49%), Positives = 34/55 (61%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 VF ++ E G L NWEGPY+V + RP Y + M K LH WNA+HL+RYY Sbjct: 515 VFQNTAERNAGKLGANWEGPYKVTTVVRPSIYELATMAGKPILHSWNAKHLKRYY 569 >gb|KFK23511.1| hypothetical protein AALP_AAs69829U000200 [Arabis alpina] Length = 1610 Score = 63.2 bits (152), Expect = 7e-08 Identities = 27/55 (49%), Positives = 34/55 (61%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 VF ++ E L NWEGPY+V + RPG Y + M K LH WNA+HL+RYY Sbjct: 1555 VFQNTAERNAWKLGANWEGPYKVTTVVRPGVYELATMAGKPILHSWNAKHLKRYY 1609 >ref|XP_009625099.1| PREDICTED: uncharacterized protein LOC104116033 [Nicotiana tomentosiformis] Length = 192 Score = 62.8 bits (151), Expect = 9e-08 Identities = 29/55 (52%), Positives = 33/55 (60%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 VF S K G G L PNWEGPY+V G Y +E MD K+ WNA HL+RYY Sbjct: 137 VFQSMKTIGSGKLNPNWEGPYKVRGIDGKGAYELETMDGKVLPSSWNAVHLKRYY 191 >gb|KFK32352.1| hypothetical protein AALP_AA6G230500 [Arabis alpina] Length = 882 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/55 (47%), Positives = 33/55 (60%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 VF ++ E G L NWEGPY+V + RPG Y + M LH WN +HL+RYY Sbjct: 827 VFQNTAERNAGKLGANWEGPYKVTAVVRPGVYELATMAGTPILHSWNVKHLKRYY 881 >gb|KFK32351.1| hypothetical protein AALP_AA6G230500 [Arabis alpina] Length = 1470 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/55 (47%), Positives = 33/55 (60%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 VF ++ E G L NWEGPY+V + RPG Y + M LH WN +HL+RYY Sbjct: 1415 VFQNTAERNAGKLGANWEGPYKVTAVVRPGVYELATMAGTPILHSWNVKHLKRYY 1469 >ref|XP_008222771.1| PREDICTED: uncharacterized protein LOC103322619 [Prunus mume] Length = 431 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/52 (50%), Positives = 34/52 (65%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLR 158 V L++K GTL P+WEGPY ++ R GTYR+ D + K HPWN EHL+ Sbjct: 125 VSLATKNPTEGTLGPSWEGPYEIIGIQRSGTYRLRDSNGKTLGHPWNVEHLK 176 >ref|XP_008229063.1| PREDICTED: uncharacterized protein LOC103328449 [Prunus mume] Length = 649 Score = 61.6 bits (148), Expect = 2e-07 Identities = 26/56 (46%), Positives = 34/56 (60%) Frame = +3 Query: 3 VFLSSKEHGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYYQ 170 V L++K GTL P WEGPY + R TY++ D K HPWNA+HL+ YY+ Sbjct: 594 VSLATKNPTEGTLGPTWEGPYEITKVYRSSTYQLRDPKGKTLPHPWNADHLKYYYK 649 >ref|XP_008345677.1| PREDICTED: uncharacterized protein LOC103408618 [Malus domestica] Length = 554 Score = 61.2 bits (147), Expect = 3e-07 Identities = 23/46 (50%), Positives = 33/46 (71%) Frame = +3 Query: 33 GTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYYQ 170 GTL PNW+GP+ V +RPG+Y++ + D K PWNA+HL+ YY+ Sbjct: 509 GTLSPNWDGPFEVXGISRPGSYKLRNSDGKTLGXPWNADHLKYYYK 554 >ref|XP_010683827.1| PREDICTED: uncharacterized protein LOC104898440 [Beta vulgaris subsp. vulgaris] Length = 1775 Score = 60.8 bits (146), Expect = 3e-07 Identities = 23/48 (47%), Positives = 34/48 (70%) Frame = +3 Query: 24 HGVGTLRPNWEGPYRVVSETRPGTYRIEDMDAKLQLHPWNAEHLRRYY 167 H G L P W+GPY+VV+E +PGTYR+E + PWNA++L++Y+ Sbjct: 1727 HLKGKLGPKWDGPYKVVAEVKPGTYRLESPEGTPLARPWNADNLKKYF 1774