BLASTX nr result
ID: Forsythia22_contig00053988
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00053988 (331 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006422813.1| hypothetical protein CICLE_v10029703mg [Citr... 60 6e-07 emb|CDY68355.1| BnaAnng27030D [Brassica napus] gi|674943115|emb|... 59 2e-06 >ref|XP_006422813.1| hypothetical protein CICLE_v10029703mg [Citrus clementina] gi|557524747|gb|ESR36053.1| hypothetical protein CICLE_v10029703mg [Citrus clementina] Length = 84 Score = 60.1 bits (144), Expect = 6e-07 Identities = 30/46 (65%), Positives = 34/46 (73%) Frame = -3 Query: 323 GIPRIELGTSRTRSENHTTRPNALLYSITLFLVS*SCLTSLTYTGW 186 GIPRIELGTSRT SENHTTRPNA L + F++ SC S +TGW Sbjct: 41 GIPRIELGTSRTLSENHTTRPNAQLLILDQFMM--SCSKSFLHTGW 84 >emb|CDY68355.1| BnaAnng27030D [Brassica napus] gi|674943115|emb|CDX90164.1| BnaA08g18200D [Brassica napus] Length = 102 Score = 58.5 bits (140), Expect = 2e-06 Identities = 25/27 (92%), Positives = 27/27 (100%) Frame = -1 Query: 325 GAFRESNSGPLAPEARIIPLDQMPCCI 245 GAFRESNSGPLAP+ARIIPLDQMPCC+ Sbjct: 67 GAFRESNSGPLAPKARIIPLDQMPCCL 93