BLASTX nr result
ID: Forsythia22_contig00052705
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00052705 (327 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERN02869.1| hypothetical protein AMTR_s00334p00011530 [Ambore... 52 3e-07 emb|CDP54793.1| Cytochrome b559 alpha chain (PsbE) [Staphylococc... 47 7e-07 >gb|ERN02869.1| hypothetical protein AMTR_s00334p00011530 [Amborella trichopoda] Length = 162 Score = 52.4 bits (124), Expect(3) = 3e-07 Identities = 26/30 (86%), Positives = 26/30 (86%) Frame = -3 Query: 184 PLTVQEYVELSMSGSTGECSFADIITSILY 95 PLTVQEY EL MSGSTGE SFADIITSI Y Sbjct: 69 PLTVQEYAELKMSGSTGERSFADIITSIRY 98 Score = 27.3 bits (59), Expect(3) = 3e-07 Identities = 11/19 (57%), Positives = 12/19 (63%) Frame = -1 Query: 240 RMQFQ*LPFTDLIFYGIDP 184 R F FTD IFYG+DP Sbjct: 50 RSDFSEFLFTDFIFYGVDP 68 Score = 20.4 bits (41), Expect(3) = 3e-07 Identities = 9/16 (56%), Positives = 12/16 (75%) Frame = -2 Query: 263 GTILTILQGCNFSDCL 216 GT+LTI Q +FS+ L Sbjct: 42 GTLLTISQRSDFSEFL 57 >emb|CDP54793.1| Cytochrome b559 alpha chain (PsbE) [Staphylococcus aureus subsp. aureus] Length = 166 Score = 46.6 bits (109), Expect(3) = 7e-07 Identities = 23/27 (85%), Positives = 24/27 (88%) Frame = -3 Query: 175 VQEYVELSMSGSTGECSFADIITSILY 95 +QEYVEL MSGSTGE SFADIITSI Y Sbjct: 76 LQEYVELGMSGSTGERSFADIITSIRY 102 Score = 31.6 bits (70), Expect(3) = 7e-07 Identities = 14/20 (70%), Positives = 14/20 (70%) Frame = -1 Query: 240 RMQFQ*LPFTDLIFYGIDPL 181 R F PFTD IFYGIDPL Sbjct: 57 RFSFGEFPFTDPIFYGIDPL 76 Score = 20.8 bits (42), Expect(3) = 7e-07 Identities = 9/15 (60%), Positives = 11/15 (73%) Frame = -2 Query: 266 FGTILTILQGCNFSD 222 FGTILTI Q +F + Sbjct: 48 FGTILTISQRFSFGE 62