BLASTX nr result
ID: Forsythia22_contig00052691
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00052691 (281 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011095492.1| PREDICTED: putative MO25-like protein At5g47... 79 9e-13 ref|XP_012849373.1| PREDICTED: putative MO25-like protein At5g47... 60 7e-07 >ref|XP_011095492.1| PREDICTED: putative MO25-like protein At5g47540 [Sesamum indicum] Length = 388 Score = 79.3 bits (194), Expect = 9e-13 Identities = 40/59 (67%), Positives = 46/59 (77%) Frame = -2 Query: 196 EKSLKRSGSSLNFKKFVAKGLGSSSMKHLFKSKKPRLPVDVVRQTRASLLCLHSGGDGG 20 + ++KRS SSLNFKK V K L SSSMK+ FKSKKPR PVD+VR+TRA LL HSG D G Sbjct: 11 DNTIKRSNSSLNFKKLVPKVLRSSSMKNPFKSKKPRTPVDIVRETRALLLYFHSGDDAG 69 >ref|XP_012849373.1| PREDICTED: putative MO25-like protein At5g47540 [Erythranthe guttatus] gi|604314699|gb|EYU27405.1| hypothetical protein MIMGU_mgv1a008042mg [Erythranthe guttata] Length = 386 Score = 59.7 bits (143), Expect = 7e-07 Identities = 31/57 (54%), Positives = 40/57 (70%) Frame = -2 Query: 196 EKSLKRSGSSLNFKKFVAKGLGSSSMKHLFKSKKPRLPVDVVRQTRASLLCLHSGGD 26 E + +RS +SL+FKK V K L S+SMK+LFKSKKPR P++VV T LL + S D Sbjct: 9 EDAFRRSSNSLSFKKLVPKVLRSTSMKNLFKSKKPRTPLEVVAATTELLLYIDSAAD 65