BLASTX nr result
ID: Forsythia22_contig00052666
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00052666 (348 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012831132.1| PREDICTED: pentatricopeptide repeat-containi... 57 4e-06 >ref|XP_012831132.1| PREDICTED: pentatricopeptide repeat-containing protein At5g66520-like [Erythranthe guttatus] Length = 614 Score = 57.4 bits (137), Expect = 4e-06 Identities = 30/63 (47%), Positives = 38/63 (60%), Gaps = 5/63 (7%) Frame = -2 Query: 182 FSRKLLCHLLCKRPPISELKKXXXXXXXXXXXS-----LTDSLIHCYLHTNNVNVARILF 18 F+ K + HLL KRPPI +K+ LTDSLIHCYLH+NN+ ARILF Sbjct: 6 FTGKSIAHLLSKRPPIFPIKQIHAQIITQSHVLSRDLSLTDSLIHCYLHSNNLGSARILF 65 Query: 17 NNY 9 +N+ Sbjct: 66 DNH 68