BLASTX nr result
ID: Forsythia22_contig00052560
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00052560 (367 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086200.1| PREDICTED: calcium permeable stress-gated ca... 61 3e-07 ref|XP_007026163.1| ERD (early-responsive to dehydration stress)... 61 3e-07 ref|XP_007026162.1| ERD (early-responsive to dehydration stress)... 61 3e-07 ref|XP_007026161.1| ERD (early-responsive to dehydration stress)... 61 3e-07 emb|CDP04437.1| unnamed protein product [Coffea canephora] 61 3e-07 ref|XP_006406250.1| hypothetical protein EUTSA_v10020132mg [Eutr... 61 3e-07 ref|XP_010326353.1| PREDICTED: CSC1-like protein At4g02900 [Sola... 60 4e-07 ref|XP_010099166.1| Uncharacterized membrane protein [Morus nota... 60 6e-07 ref|XP_010089460.1| Uncharacterized membrane protein [Morus nota... 60 6e-07 gb|KJB69243.1| hypothetical protein B456_011G012200 [Gossypium r... 60 6e-07 gb|KJB69241.1| hypothetical protein B456_011G012200 [Gossypium r... 60 6e-07 gb|KJB69239.1| hypothetical protein B456_011G012200 [Gossypium r... 60 6e-07 gb|KJB69238.1| hypothetical protein B456_011G012200 [Gossypium r... 60 6e-07 gb|KJB69237.1| hypothetical protein B456_011G012200 [Gossypium r... 60 6e-07 ref|XP_012455376.1| PREDICTED: calcium permeable stress-gated ca... 60 6e-07 ref|XP_010546606.1| PREDICTED: CSC1-like protein At1g11960 [Tare... 60 6e-07 gb|KHG01808.1| putative membrane C2G11.09 [Gossypium arboreum] 60 6e-07 ref|XP_008455928.1| PREDICTED: uncharacterized membrane protein ... 60 6e-07 gb|AAC17615.1| Similar to hypothetical protein HYP1 gb|Z97338 fr... 60 6e-07 gb|KJB10674.1| hypothetical protein B456_001G215500 [Gossypium r... 60 7e-07 >ref|XP_011086200.1| PREDICTED: calcium permeable stress-gated cation channel 1-like [Sesamum indicum] gi|747078095|ref|XP_011086201.1| PREDICTED: calcium permeable stress-gated cation channel 1-like [Sesamum indicum] gi|747078097|ref|XP_011086202.1| PREDICTED: calcium permeable stress-gated cation channel 1-like [Sesamum indicum] Length = 775 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSESVEHFFLVNHPD Sbjct: 204 VLVRNVPPDPDESVSESVEHFFLVNHPD 231 >ref|XP_007026163.1| ERD (early-responsive to dehydration stress) family protein isoform 3 [Theobroma cacao] gi|508781529|gb|EOY28785.1| ERD (early-responsive to dehydration stress) family protein isoform 3 [Theobroma cacao] Length = 521 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSESVEHFFLVNHPD Sbjct: 202 VLVRNVPPDPDESVSESVEHFFLVNHPD 229 >ref|XP_007026162.1| ERD (early-responsive to dehydration stress) family protein isoform 2 [Theobroma cacao] gi|508781528|gb|EOY28784.1| ERD (early-responsive to dehydration stress) family protein isoform 2 [Theobroma cacao] Length = 618 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSESVEHFFLVNHPD Sbjct: 202 VLVRNVPPDPDESVSESVEHFFLVNHPD 229 >ref|XP_007026161.1| ERD (early-responsive to dehydration stress) family protein isoform 1 [Theobroma cacao] gi|508781527|gb|EOY28783.1| ERD (early-responsive to dehydration stress) family protein isoform 1 [Theobroma cacao] Length = 771 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/28 (96%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSESVEHFFLVNHPD Sbjct: 202 VLVRNVPPDPDESVSESVEHFFLVNHPD 229 >emb|CDP04437.1| unnamed protein product [Coffea canephora] Length = 768 Score = 60.8 bits (146), Expect = 3e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLVKNVPPDPDES+SE+VEHFFLVNHPD Sbjct: 200 VLVKNVPPDPDESISETVEHFFLVNHPD 227 >ref|XP_006406250.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum] gi|557107396|gb|ESQ47703.1| hypothetical protein EUTSA_v10020132mg [Eutrema salsugineum] Length = 757 Score = 60.8 bits (146), Expect = 3e-07 Identities = 38/92 (41%), Positives = 52/92 (56%) Frame = -3 Query: 278 FWMHLATLISVFIVNYSRFMLKMP*FRRHI*CDYHILILVNLEMIFILLVVYHF*DCRYF 99 FW+HL ++ FI ++ F+L+ +Y I+ + L+ + D R Sbjct: 156 FWVHLC--MAYFITFWTCFVLQR---------EYKIIGSMRLQFLAS--------DQRRP 196 Query: 98 DFSQVLVKNVPPDPDESVSESVEHFFLVNHPD 3 D VLV+N+PPDPDESVSE VEHFF VNHPD Sbjct: 197 DQFTVLVRNIPPDPDESVSELVEHFFKVNHPD 228 >ref|XP_010326353.1| PREDICTED: CSC1-like protein At4g02900 [Solanum lycopersicum] Length = 751 Score = 60.5 bits (145), Expect = 4e-07 Identities = 36/92 (39%), Positives = 51/92 (55%) Frame = -3 Query: 278 FWMHLATLISVFIVNYSRFMLKMP*FRRHI*CDYHILILVNLEMIFILLVVYHF*DCRYF 99 FW HL +++ + ++ ++L +YHI+ + L+ + + R Sbjct: 156 FWAHL--VVAYVVTFWTCYVLYK---------EYHIITTMRLQFLAS--------ENRRP 196 Query: 98 DFSQVLVKNVPPDPDESVSESVEHFFLVNHPD 3 D VLV+NVPPDPDESVSE VEHFF VNHPD Sbjct: 197 DQFTVLVRNVPPDPDESVSEHVEHFFCVNHPD 228 >ref|XP_010099166.1| Uncharacterized membrane protein [Morus notabilis] gi|587888330|gb|EXB77038.1| Uncharacterized membrane protein [Morus notabilis] Length = 779 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSE+VEHFFLVNHPD Sbjct: 204 VLVRNVPPDPDESVSENVEHFFLVNHPD 231 >ref|XP_010089460.1| Uncharacterized membrane protein [Morus notabilis] gi|587847491|gb|EXB37853.1| Uncharacterized membrane protein [Morus notabilis] Length = 779 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSE+VEHFFLVNHPD Sbjct: 200 VLVRNVPPDPDESVSENVEHFFLVNHPD 227 >gb|KJB69243.1| hypothetical protein B456_011G012200 [Gossypium raimondii] Length = 764 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSE+VEHFFLVNHPD Sbjct: 194 VLVRNVPPDPDESVSETVEHFFLVNHPD 221 >gb|KJB69241.1| hypothetical protein B456_011G012200 [Gossypium raimondii] Length = 341 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSE+VEHFFLVNHPD Sbjct: 40 VLVRNVPPDPDESVSETVEHFFLVNHPD 67 >gb|KJB69239.1| hypothetical protein B456_011G012200 [Gossypium raimondii] Length = 772 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSE+VEHFFLVNHPD Sbjct: 202 VLVRNVPPDPDESVSETVEHFFLVNHPD 229 >gb|KJB69238.1| hypothetical protein B456_011G012200 [Gossypium raimondii] gi|763802302|gb|KJB69240.1| hypothetical protein B456_011G012200 [Gossypium raimondii] Length = 610 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSE+VEHFFLVNHPD Sbjct: 40 VLVRNVPPDPDESVSETVEHFFLVNHPD 67 >gb|KJB69237.1| hypothetical protein B456_011G012200 [Gossypium raimondii] Length = 612 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSE+VEHFFLVNHPD Sbjct: 202 VLVRNVPPDPDESVSETVEHFFLVNHPD 229 >ref|XP_012455376.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Gossypium raimondii] gi|823245429|ref|XP_012455377.1| PREDICTED: calcium permeable stress-gated cation channel 1 [Gossypium raimondii] gi|763802298|gb|KJB69236.1| hypothetical protein B456_011G012200 [Gossypium raimondii] gi|763802304|gb|KJB69242.1| hypothetical protein B456_011G012200 [Gossypium raimondii] gi|763802306|gb|KJB69244.1| hypothetical protein B456_011G012200 [Gossypium raimondii] Length = 772 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSE+VEHFFLVNHPD Sbjct: 202 VLVRNVPPDPDESVSETVEHFFLVNHPD 229 >ref|XP_010546606.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana] gi|729297284|ref|XP_010546613.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana] gi|729297287|ref|XP_010546622.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana] gi|729297290|ref|XP_010546631.1| PREDICTED: CSC1-like protein At1g11960 [Tarenaya hassleriana] Length = 776 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSE+VEHFFLVNHPD Sbjct: 203 VLVRNVPPDPDESVSENVEHFFLVNHPD 230 >gb|KHG01808.1| putative membrane C2G11.09 [Gossypium arboreum] Length = 772 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/28 (92%), Positives = 28/28 (100%) Frame = -3 Query: 86 VLVKNVPPDPDESVSESVEHFFLVNHPD 3 VLV+NVPPDPDESVSE+VEHFFLVNHPD Sbjct: 202 VLVRNVPPDPDESVSETVEHFFLVNHPD 229 >ref|XP_008455928.1| PREDICTED: uncharacterized membrane protein YLR241W isoform X3 [Cucumis melo] Length = 629 Score = 60.1 bits (144), Expect = 6e-07 Identities = 36/96 (37%), Positives = 52/96 (54%) Frame = -3 Query: 290 HMQFFWMHLATLISVFIVNYSRFMLKMP*FRRHI*CDYHILILVNLEMIFILLVVYHF*D 111 H+ FW HL +++ ++ ++L+ +Y I+ + L + + Sbjct: 12 HLDIFWTHL--VMAYVFTFWTCYILRK---------EYEIVASMRLHFLAS--------E 52 Query: 110 CRYFDFSQVLVKNVPPDPDESVSESVEHFFLVNHPD 3 R D V+V+NVPPDPDESVSE VEHFFLVNHPD Sbjct: 53 NRRPDQYTVIVRNVPPDPDESVSELVEHFFLVNHPD 88 >gb|AAC17615.1| Similar to hypothetical protein HYP1 gb|Z97338 from A. thaliana [Arabidopsis thaliana] Length = 783 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/30 (86%), Positives = 29/30 (96%) Frame = -3 Query: 92 SQVLVKNVPPDPDESVSESVEHFFLVNHPD 3 SQVLV+NVP DPDES+S+SVEHFFLVNHPD Sbjct: 216 SQVLVRNVPADPDESISDSVEHFFLVNHPD 245 >gb|KJB10674.1| hypothetical protein B456_001G215500 [Gossypium raimondii] Length = 729 Score = 59.7 bits (143), Expect = 7e-07 Identities = 28/35 (80%), Positives = 30/35 (85%) Frame = -3 Query: 107 RYFDFSQVLVKNVPPDPDESVSESVEHFFLVNHPD 3 R+ D VLVKNVPPDPDESVSE VEHFFLVNHP+ Sbjct: 154 RHPDQFTVLVKNVPPDPDESVSELVEHFFLVNHPE 188