BLASTX nr result
ID: Forsythia22_contig00051954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00051954 (529 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011079118.1| PREDICTED: probable arabinosyltransferase AR... 60 7e-07 >ref|XP_011079118.1| PREDICTED: probable arabinosyltransferase ARAD1 [Sesamum indicum] Length = 479 Score = 59.7 bits (143), Expect = 7e-07 Identities = 26/35 (74%), Positives = 32/35 (91%) Frame = -2 Query: 111 MSKMGLLTHRSLFCLFLMTSIVFILSWFFVLRSTG 7 MSKMGLL+++SLFC FLMTS++F+ SWF VLRSTG Sbjct: 1 MSKMGLLSYKSLFCWFLMTSVLFMFSWFLVLRSTG 35