BLASTX nr result
ID: Forsythia22_contig00049853
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00049853 (406 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ACD43485.1| lipoxygenase 2 [Olea europaea] 65 2e-08 >gb|ACD43485.1| lipoxygenase 2 [Olea europaea] Length = 901 Score = 65.1 bits (157), Expect = 2e-08 Identities = 41/61 (67%), Positives = 44/61 (72%) Frame = +1 Query: 223 MLNQINISKSQYSHQILLPNYKPFIVGTGGNACFAVTQKFKSVRKLENVRVGRASRTIKE 402 MLN ++ISKSQ +HQILLPN PF G NA FA KFKSVRK ENVRVGR S TIK Sbjct: 1 MLN-LSISKSQ-THQILLPNCNPFFFGRR-NASFAGNPKFKSVRKHENVRVGRGSSTIKA 57 Query: 403 V 405 V Sbjct: 58 V 58