BLASTX nr result
ID: Forsythia22_contig00049828
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00049828 (268 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011075332.1| PREDICTED: pentatricopeptide repeat-containi... 97 3e-18 ref|XP_012828099.1| PREDICTED: pentatricopeptide repeat-containi... 94 4e-17 gb|EYU18728.1| hypothetical protein MIMGU_mgv1a003317mg [Erythra... 94 4e-17 ref|XP_009766339.1| PREDICTED: pentatricopeptide repeat-containi... 93 6e-17 ref|XP_009589364.1| PREDICTED: pentatricopeptide repeat-containi... 93 6e-17 emb|CDP14119.1| unnamed protein product [Coffea canephora] 92 1e-16 ref|XP_012086185.1| PREDICTED: pentatricopeptide repeat-containi... 89 2e-15 gb|KDP26067.1| hypothetical protein JCGZ_21100 [Jatropha curcas] 89 2e-15 ref|XP_002529510.1| pentatricopeptide repeat-containing protein,... 84 4e-14 ref|XP_012459746.1| PREDICTED: pentatricopeptide repeat-containi... 82 1e-13 ref|XP_010316424.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_009363299.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_008371947.1| PREDICTED: pentatricopeptide repeat-containi... 81 2e-13 ref|XP_007014350.1| Pentatricopeptide repeat (PPR) superfamily p... 81 2e-13 ref|XP_008225970.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-13 ref|XP_006340743.1| PREDICTED: pentatricopeptide repeat-containi... 81 3e-13 gb|KDO48200.1| hypothetical protein CISIN_1g047305mg, partial [C... 79 2e-12 ref|XP_007213627.1| hypothetical protein PRUPE_ppa002066mg [Prun... 77 6e-12 ref|XP_010252156.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 ref|XP_006492928.1| PREDICTED: pentatricopeptide repeat-containi... 76 8e-12 >ref|XP_011075332.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Sesamum indicum] Length = 806 Score = 97.4 bits (241), Expect = 3e-18 Identities = 44/82 (53%), Positives = 65/82 (79%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 E KL+EA +IFLYT EKG++L+P +CN++ + LL S++K+ LAFELL +MKSMGY+LN++ Sbjct: 723 EKKLNEAVDIFLYTMEKGHRLMPPVCNSLLKVLLSSKDKAGLAFELLDKMKSMGYDLNSF 782 Query: 87 LQLRTKYLLHHQWNRRETEDMS 22 L+ TK LHH + R+ E++S Sbjct: 783 LRRSTKSRLHHHYRMRKRENVS 804 >ref|XP_012828099.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Erythranthe guttatus] Length = 811 Score = 94.0 bits (232), Expect = 4e-17 Identities = 39/81 (48%), Positives = 65/81 (80%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG L +A ++FLYT E+GY+L+PR+CN + Q LL S+E++ +AFELL +MKS+GY+LN+ Sbjct: 726 EGNLGKAVDVFLYTIERGYKLMPRVCNGLLQRLLGSKERAVVAFELLDKMKSVGYDLNSC 785 Query: 87 LQLRTKYLLHHQWNRRETEDM 25 + T++L+ H++N R++E++ Sbjct: 786 VHHNTRFLIRHRYNERKSENV 806 >gb|EYU18728.1| hypothetical protein MIMGU_mgv1a003317mg [Erythranthe guttata] Length = 592 Score = 94.0 bits (232), Expect = 4e-17 Identities = 39/81 (48%), Positives = 65/81 (80%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG L +A ++FLYT E+GY+L+PR+CN + Q LL S+E++ +AFELL +MKS+GY+LN+ Sbjct: 507 EGNLGKAVDVFLYTIERGYKLMPRVCNGLLQRLLGSKERAVVAFELLDKMKSVGYDLNSC 566 Query: 87 LQLRTKYLLHHQWNRRETEDM 25 + T++L+ H++N R++E++ Sbjct: 567 VHHNTRFLIRHRYNERKSENV 587 >ref|XP_009766339.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana sylvestris] gi|698542253|ref|XP_009766340.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana sylvestris] gi|698542256|ref|XP_009766341.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana sylvestris] gi|698542259|ref|XP_009766343.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana sylvestris] gi|698542262|ref|XP_009766344.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana sylvestris] gi|698542265|ref|XP_009766345.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana sylvestris] Length = 789 Score = 93.2 bits (230), Expect = 6e-17 Identities = 46/82 (56%), Positives = 59/82 (71%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG LD+A E+FLYT E+G +L+PRICN + Q LL SQ+K+ A +LL RM+S GYNLN Y Sbjct: 707 EGNLDQAVEVFLYTVERGVRLMPRICNRLLQTLLRSQDKAQHAVDLLERMRSTGYNLNDY 766 Query: 87 LQLRTKYLLHHQWNRRETEDMS 22 L T+ L +WNRR TE +S Sbjct: 767 LHSGTRSLF-QRWNRRGTESLS 787 >ref|XP_009589364.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana tomentosiformis] gi|697161175|ref|XP_009589365.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana tomentosiformis] gi|697161177|ref|XP_009589366.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana tomentosiformis] gi|697161179|ref|XP_009589367.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana tomentosiformis] gi|697161181|ref|XP_009589368.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nicotiana tomentosiformis] Length = 803 Score = 93.2 bits (230), Expect = 6e-17 Identities = 46/82 (56%), Positives = 59/82 (71%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG LD+A E+FLYT E+G +L+PRICN + Q LL SQ+K+ A +LL RM+S GYNLN Y Sbjct: 721 EGNLDQAVEVFLYTVERGVRLMPRICNRLLQTLLRSQDKAQHAVDLLERMRSTGYNLNDY 780 Query: 87 LQLRTKYLLHHQWNRRETEDMS 22 L T+ L +WNRR TE +S Sbjct: 781 LHSGTRSLF-QRWNRRGTESLS 801 >emb|CDP14119.1| unnamed protein product [Coffea canephora] Length = 808 Score = 92.4 bits (228), Expect = 1e-16 Identities = 49/84 (58%), Positives = 62/84 (73%), Gaps = 2/84 (2%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 +GKLD+A IFLYT EKG +L+PRICNN+ LL SQEK+ AF LL MKSMGYNL++Y Sbjct: 723 DGKLDQAISIFLYTLEKGIRLMPRICNNLLTMLLHSQEKAEDAFYLLKEMKSMGYNLDSY 782 Query: 87 LQLRTKYLL-HHQWNR-RETEDMS 22 L TK LL HH++ + R+ E +S Sbjct: 783 LYKNTKSLLIHHRYRKVRKLESVS 806 >ref|XP_012086185.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Jatropha curcas] Length = 931 Score = 88.6 bits (218), Expect = 2e-15 Identities = 45/72 (62%), Positives = 54/72 (75%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG LD A EIFLYT E+GY L+PRICN + + LLCS++K A +LLSRMKS+GY+LNAY Sbjct: 712 EGNLDFAAEIFLYTIEEGYMLMPRICNRLLKCLLCSEDKRYRALDLLSRMKSLGYDLNAY 771 Query: 87 LQLRTKYLLHHQ 52 L TK LH Q Sbjct: 772 LHRTTK--LHLQ 781 >gb|KDP26067.1| hypothetical protein JCGZ_21100 [Jatropha curcas] Length = 499 Score = 88.6 bits (218), Expect = 2e-15 Identities = 45/72 (62%), Positives = 54/72 (75%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG LD A EIFLYT E+GY L+PRICN + + LLCS++K A +LLSRMKS+GY+LNAY Sbjct: 280 EGNLDFAAEIFLYTIEEGYMLMPRICNRLLKCLLCSEDKRYRALDLLSRMKSLGYDLNAY 339 Query: 87 LQLRTKYLLHHQ 52 L TK LH Q Sbjct: 340 LHRTTK--LHLQ 349 >ref|XP_002529510.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223531026|gb|EEF32879.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 804 Score = 84.0 bits (206), Expect = 4e-14 Identities = 40/68 (58%), Positives = 54/68 (79%) Frame = -2 Query: 264 GKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAYL 85 G LD A EIFLYT +KGY L+PRICN + ++LL S++K AF+LLSRMKS+GY+L+++L Sbjct: 712 GNLDLAAEIFLYTIDKGYMLMPRICNRLLKSLLRSEDKRNRAFDLLSRMKSLGYDLDSHL 771 Query: 84 QLRTKYLL 61 TK+LL Sbjct: 772 HQTTKFLL 779 >ref|XP_012459746.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Gossypium raimondii] Length = 800 Score = 82.4 bits (202), Expect = 1e-13 Identities = 39/82 (47%), Positives = 60/82 (73%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 E LD+A ++FLYT EKG++L+PR+CN + ++LL S++K AF+LLS+M S Y+L+AY Sbjct: 717 ERNLDQAADMFLYTLEKGFKLMPRVCNYLLRSLLRSKDKRMYAFDLLSKMNSQRYDLDAY 776 Query: 87 LQLRTKYLLHHQWNRRETEDMS 22 L TK LL+ + RET+ ++ Sbjct: 777 LHKTTKSLLYMHRHARETKSLA 798 >ref|XP_010316424.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Solanum lycopersicum] gi|723672748|ref|XP_010316425.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Solanum lycopersicum] Length = 775 Score = 81.3 bits (199), Expect = 2e-13 Identities = 39/68 (57%), Positives = 51/68 (75%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG LD+A E+FLYT E+G +L+PRICN + Q+LL SQ+K+ AF LL RM+S GYNL+ Y Sbjct: 705 EGNLDQAVEVFLYTLERGVRLMPRICNKLLQSLLRSQDKAQHAFGLLERMRSTGYNLDDY 764 Query: 87 LQLRTKYL 64 L T+ L Sbjct: 765 LHRGTRSL 772 >ref|XP_009363299.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Pyrus x bretschneideri] gi|694371512|ref|XP_009363300.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Pyrus x bretschneideri] gi|694371515|ref|XP_009363301.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Pyrus x bretschneideri] gi|694371519|ref|XP_009363302.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Pyrus x bretschneideri] gi|694371522|ref|XP_009363303.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Pyrus x bretschneideri] Length = 785 Score = 81.3 bits (199), Expect = 2e-13 Identities = 38/74 (51%), Positives = 53/74 (71%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG LD A +F+YT EKG+ L+P ICN + + LL SQ+K A +L+SRM+S+GY+L++Y Sbjct: 712 EGNLDLAIGVFIYTLEKGFMLMPEICNTLLKCLLRSQDKKDHALDLVSRMRSLGYDLDSY 771 Query: 87 LQLRTKYLLHHQWN 46 LQ TK+LL N Sbjct: 772 LQQTTKFLLQCHGN 785 >ref|XP_008371947.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Malus domestica] gi|657960736|ref|XP_008371948.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Malus domestica] gi|657960738|ref|XP_008371949.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Malus domestica] gi|657960740|ref|XP_008371951.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Malus domestica] Length = 785 Score = 81.3 bits (199), Expect = 2e-13 Identities = 38/74 (51%), Positives = 53/74 (71%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG LD A +F+YT EKG+ L+P ICN + + LL SQ+K A +L+SRM+S+GY+L++Y Sbjct: 712 EGNLDLAIGVFIYTLEKGFMLMPEICNTLLKCLLRSQDKKDHALDLVSRMRSLGYDLDSY 771 Query: 87 LQLRTKYLLHHQWN 46 LQ TK+LL N Sbjct: 772 LQQTTKFLLQCHGN 785 >ref|XP_007014350.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] gi|508784713|gb|EOY31969.1| Pentatricopeptide repeat (PPR) superfamily protein, putative [Theobroma cacao] Length = 800 Score = 81.3 bits (199), Expect = 2e-13 Identities = 39/80 (48%), Positives = 57/80 (71%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG LD A ++FLYT E+G++L+PRICN + ++LL S++K AF LLS+M S Y+L+AY Sbjct: 717 EGNLDLAVDVFLYTLEQGFKLMPRICNYLLKSLLRSKDKRMHAFGLLSKMNSQRYDLDAY 776 Query: 87 LQLRTKYLLHHQWNRRETED 28 L TK LL+ W+ + E+ Sbjct: 777 LHKTTKSLLYRHWHTWKMEN 796 >ref|XP_008225970.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Prunus mume] Length = 785 Score = 80.9 bits (198), Expect = 3e-13 Identities = 38/74 (51%), Positives = 51/74 (68%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG LD+A +FLYT EKG+ L+P ICN + + LL SQ+K A +L+SRM+S GY+L+ Y Sbjct: 712 EGNLDQAIGVFLYTLEKGFMLMPEICNQLLKCLLRSQDKKDHALDLISRMRSFGYDLDFY 771 Query: 87 LQLRTKYLLHHQWN 46 L TK+LL N Sbjct: 772 LHQTTKFLLECHMN 785 >ref|XP_006340743.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Solanum tuberosum] Length = 775 Score = 80.9 bits (198), Expect = 3e-13 Identities = 39/68 (57%), Positives = 51/68 (75%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG LD+A E+FLYT E+G +L+PRICN + Q+LL SQ+K+ AF LL RM+S GYNL+ Y Sbjct: 705 EGNLDQAVEVFLYTLERGVRLMPRICNKLLQSLLHSQDKAHHAFGLLERMRSTGYNLDDY 764 Query: 87 LQLRTKYL 64 L T+ L Sbjct: 765 LHRGTRSL 772 >gb|KDO48200.1| hypothetical protein CISIN_1g047305mg, partial [Citrus sinensis] Length = 767 Score = 78.6 bits (192), Expect = 2e-12 Identities = 41/82 (50%), Positives = 57/82 (69%), Gaps = 1/82 (1%) Frame = -2 Query: 264 GKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQE-KSALAFELLSRMKSMGYNLNAY 88 G LD A ++FLYT + G+ L PR+CN + ++LL S++ K A+ LL RMKS+GY+L+A Sbjct: 684 GYLDLAMDVFLYTLKNGFILRPRVCNYLLRSLLFSKDNKKVHAYHLLCRMKSVGYDLDAC 743 Query: 87 LQLRTKYLLHHQWNRRETEDMS 22 L +TK LL WN RE E+MS Sbjct: 744 LYPKTKSLLPGPWNTREMENMS 765 >ref|XP_007213627.1| hypothetical protein PRUPE_ppa002066mg [Prunus persica] gi|462409492|gb|EMJ14826.1| hypothetical protein PRUPE_ppa002066mg [Prunus persica] Length = 722 Score = 76.6 bits (187), Expect = 6e-12 Identities = 37/74 (50%), Positives = 49/74 (66%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG LD A +F YT EKG+ L+P ICN + + LL SQ+K A +L+SRM+S GY+L+ Y Sbjct: 649 EGNLDLAIGVFRYTLEKGFMLMPEICNQLLKCLLRSQDKKDHALDLISRMRSFGYDLDFY 708 Query: 87 LQLRTKYLLHHQWN 46 L TK+LL N Sbjct: 709 LHQTTKFLLECHMN 722 >ref|XP_010252156.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540 [Nelumbo nucifera] Length = 827 Score = 76.3 bits (186), Expect = 8e-12 Identities = 40/79 (50%), Positives = 53/79 (67%) Frame = -2 Query: 267 EGKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQEKSALAFELLSRMKSMGYNLNAY 88 EG LD A +IF+YT EKG+ L+P +CN M ++ LCSQ+K LLSRMKS+GY+L+ Y Sbjct: 741 EGNLDLAVDIFVYTLEKGFILMPPVCNRMIRS-LCSQDKKNHVINLLSRMKSVGYDLDVY 799 Query: 87 LQLRTKYLLHHQWNRRETE 31 L TK LL+ R + E Sbjct: 800 LNQTTKALLYGMKPRYKME 818 >ref|XP_006492928.1| PREDICTED: pentatricopeptide repeat-containing protein At1g79540-like [Citrus sinensis] Length = 869 Score = 76.3 bits (186), Expect = 8e-12 Identities = 40/82 (48%), Positives = 56/82 (68%), Gaps = 1/82 (1%) Frame = -2 Query: 264 GKLDEAFEIFLYTKEKGYQLLPRICNNMFQALLCSQE-KSALAFELLSRMKSMGYNLNAY 88 G LD A ++FLYT + + L PR+CN + ++LL S++ K A+ LL RMKS+GY+L+A Sbjct: 786 GYLDLAMDVFLYTLKNDFILRPRVCNYLLRSLLLSKDNKKVHAYHLLRRMKSVGYDLDAC 845 Query: 87 LQLRTKYLLHHQWNRRETEDMS 22 L +TK LL WN RE E+MS Sbjct: 846 LYPKTKSLLPGPWNTREMENMS 867