BLASTX nr result
ID: Forsythia22_contig00049783
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00049783 (274 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012855856.1| PREDICTED: uncharacterized protein LOC105975... 66 8e-09 gb|EYU44607.1| hypothetical protein MIMGU_mgv11b021844mg [Erythr... 66 8e-09 ref|XP_009594893.1| PREDICTED: uncharacterized protein LOC104091... 66 1e-08 ref|XP_012832552.1| PREDICTED: uncharacterized protein LOC105953... 66 1e-08 ref|XP_010660387.1| PREDICTED: uncharacterized protein LOC104881... 64 3e-08 ref|XP_011100112.1| PREDICTED: uncharacterized protein LOC105178... 63 7e-08 ref|XP_007033166.1| Uncharacterized protein TCM_019359 [Theobrom... 63 9e-08 emb|CDP02744.1| unnamed protein product [Coffea canephora] 59 1e-06 >ref|XP_012855856.1| PREDICTED: uncharacterized protein LOC105975223 [Erythranthe guttatus] Length = 135 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = -1 Query: 274 TSKGGNTFGAKRIPKVREVPTDYSRTEFDNRLIHEIYKSMVASMELSSTR 125 ++ G + FGAKRIPK R+ P YSRTEF+NRL+ EIYKSMVAS EL ++ Sbjct: 84 SANGVSVFGAKRIPKSRDAPMAYSRTEFENRLVFEIYKSMVASFELGYSK 133 >gb|EYU44607.1| hypothetical protein MIMGU_mgv11b021844mg [Erythranthe guttata] Length = 149 Score = 66.2 bits (160), Expect = 8e-09 Identities = 31/50 (62%), Positives = 39/50 (78%) Frame = -1 Query: 274 TSKGGNTFGAKRIPKVREVPTDYSRTEFDNRLIHEIYKSMVASMELSSTR 125 ++ G + FGAKRIPK R+ P YSRTEF+NRL+ EIYKSMVAS EL ++ Sbjct: 98 SANGVSVFGAKRIPKSRDAPMAYSRTEFENRLVFEIYKSMVASFELGYSK 147 >ref|XP_009594893.1| PREDICTED: uncharacterized protein LOC104091284 [Nicotiana tomentosiformis] Length = 137 Score = 65.9 bits (159), Expect = 1e-08 Identities = 31/42 (73%), Positives = 34/42 (80%) Frame = -1 Query: 262 GNTFGAKRIPKVREVPTDYSRTEFDNRLIHEIYKSMVASMEL 137 GN FGAKRIPK RE Y+ TEF+NRLI+EIYKSMV SMEL Sbjct: 92 GNVFGAKRIPKAREAKLGYTNTEFENRLIYEIYKSMVPSMEL 133 >ref|XP_012832552.1| PREDICTED: uncharacterized protein LOC105953437 [Erythranthe guttatus] gi|604342241|gb|EYU41305.1| hypothetical protein MIMGU_mgv1a015849mg [Erythranthe guttata] Length = 143 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/47 (70%), Positives = 37/47 (78%), Gaps = 1/47 (2%) Frame = -1 Query: 274 TSKGGNTFGAKRIPKVREV-PTDYSRTEFDNRLIHEIYKSMVASMEL 137 TS GN FG KRIPK RE P YSR+EF+NRL+ EIYKSMVAS+EL Sbjct: 92 TSNSGNVFGTKRIPKAREAAPMAYSRSEFENRLVLEIYKSMVASLEL 138 >ref|XP_010660387.1| PREDICTED: uncharacterized protein LOC104881559 [Vitis vinifera] Length = 132 Score = 64.3 bits (155), Expect = 3e-08 Identities = 29/42 (69%), Positives = 33/42 (78%) Frame = -1 Query: 262 GNTFGAKRIPKVREVPTDYSRTEFDNRLIHEIYKSMVASMEL 137 GN FG KR+PK R+VP YS EFDNRL+ EIYKSM+AS EL Sbjct: 88 GNVFGGKRVPKARQVPIAYSNEEFDNRLVLEIYKSMIASREL 129 >ref|XP_011100112.1| PREDICTED: uncharacterized protein LOC105178343 [Sesamum indicum] Length = 138 Score = 63.2 bits (152), Expect = 7e-08 Identities = 30/45 (66%), Positives = 35/45 (77%) Frame = -1 Query: 271 SKGGNTFGAKRIPKVREVPTDYSRTEFDNRLIHEIYKSMVASMEL 137 S + FGAKRIPK R P YSRTEF+NRL+ EIYKS+VAS+EL Sbjct: 86 SNTSSVFGAKRIPKARGAPMAYSRTEFENRLVFEIYKSVVASLEL 130 >ref|XP_007033166.1| Uncharacterized protein TCM_019359 [Theobroma cacao] gi|508712195|gb|EOY04092.1| Uncharacterized protein TCM_019359 [Theobroma cacao] Length = 135 Score = 62.8 bits (151), Expect = 9e-08 Identities = 28/43 (65%), Positives = 35/43 (81%) Frame = -1 Query: 259 NTFGAKRIPKVREVPTDYSRTEFDNRLIHEIYKSMVASMELSS 131 NTFG KRIPK R+VP YS EFD RL++EIYK++VA+ ELS+ Sbjct: 92 NTFGGKRIPKARQVPVVYSSNEFDQRLVYEIYKALVATRELSA 134 >emb|CDP02744.1| unnamed protein product [Coffea canephora] Length = 133 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/44 (59%), Positives = 32/44 (72%) Frame = -1 Query: 262 GNTFGAKRIPKVREVPTDYSRTEFDNRLIHEIYKSMVASMELSS 131 GN F KRIP+ R VP Y +EF+NRLI+EIYKS+ SME+ S Sbjct: 89 GNDFAGKRIPEARPVPVTYKNSEFENRLIYEIYKSLAVSMEMDS 132