BLASTX nr result
ID: Forsythia22_contig00048850
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00048850 (243 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011073004.1| PREDICTED: AT-rich interactive domain-contai... 139 7e-31 ref|XP_012836265.1| PREDICTED: AT-rich interactive domain-contai... 117 3e-24 emb|CDP12045.1| unnamed protein product [Coffea canephora] 116 5e-24 ref|XP_009790421.1| PREDICTED: AT-rich interactive domain-contai... 107 3e-21 ref|XP_009790417.1| PREDICTED: AT-rich interactive domain-contai... 107 3e-21 ref|XP_009591217.1| PREDICTED: AT-rich interactive domain-contai... 103 4e-20 ref|XP_009591214.1| PREDICTED: AT-rich interactive domain-contai... 103 4e-20 gb|KHM99959.1| AT-rich interactive domain-containing protein 2 [... 102 1e-19 ref|XP_010275662.1| PREDICTED: AT-rich interactive domain-contai... 100 3e-19 ref|XP_008238928.1| PREDICTED: AT-rich interactive domain-contai... 100 3e-19 ref|XP_007208888.1| hypothetical protein PRUPE_ppa026661mg [Prun... 100 3e-19 ref|XP_003524452.1| PREDICTED: AT-rich interactive domain-contai... 100 3e-19 ref|XP_003532418.1| PREDICTED: AT-rich interactive domain-contai... 100 4e-19 ref|XP_010658131.1| PREDICTED: AT-rich interactive domain-contai... 100 6e-19 emb|CBI34361.3| unnamed protein product [Vitis vinifera] 100 6e-19 ref|XP_002298024.2| hypothetical protein POPTR_0001s09620g [Popu... 100 6e-19 emb|CAN60589.1| hypothetical protein VITISV_023124 [Vitis vinifera] 100 6e-19 ref|XP_012086862.1| PREDICTED: AT-rich interactive domain-contai... 99 8e-19 ref|XP_012086861.1| PREDICTED: AT-rich interactive domain-contai... 99 8e-19 ref|XP_002509831.1| DNA binding protein, putative [Ricinus commu... 99 1e-18 >ref|XP_011073004.1| PREDICTED: AT-rich interactive domain-containing protein 2-like [Sesamum indicum] Length = 728 Score = 139 bits (350), Expect = 7e-31 Identities = 66/77 (85%), Positives = 69/77 (89%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPKKFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQN 64 VSLSWT+EEEKRFKDMMRS+AAF KFWN A FLPSKTRE+LVSYYFNVFLVQRRSYQN Sbjct: 621 VSLSWTEEEEKRFKDMMRSYAAFSNKFWNTASRFLPSKTREKLVSYYFNVFLVQRRSYQN 680 Query: 63 RVCPNDIDCDDDEKECG 13 RV P DID DDDEKECG Sbjct: 681 RVTPKDIDSDDDEKECG 697 >ref|XP_012836265.1| PREDICTED: AT-rich interactive domain-containing protein 2 [Erythranthe guttatus] gi|604334233|gb|EYU38330.1| hypothetical protein MIMGU_mgv1a001780mg [Erythranthe guttata] Length = 760 Score = 117 bits (293), Expect = 3e-24 Identities = 56/77 (72%), Positives = 61/77 (79%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPKKFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQN 64 VSL WT+EE KRFK M RS+A F KFW NA LP KTRE LVSYYFNVFL++RRSYQN Sbjct: 653 VSLFWTEEEVKRFKCMTRSYAPFSNKFWKNAPKSLPLKTRENLVSYYFNVFLIERRSYQN 712 Query: 63 RVCPNDIDCDDDEKECG 13 RV P D+D DDDEKECG Sbjct: 713 RVNPRDVDSDDDEKECG 729 >emb|CDP12045.1| unnamed protein product [Coffea canephora] Length = 686 Score = 116 bits (291), Expect = 5e-24 Identities = 53/77 (68%), Positives = 63/77 (81%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPKKFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQN 64 VSLSWT E EK+FKDM+R ++A KFW+NA PS TR++LVSYYFNVFLV+RRSYQN Sbjct: 579 VSLSWTAEHEKKFKDMIRLNSASTNKFWSNAFRIFPSTTRDKLVSYYFNVFLVRRRSYQN 638 Query: 63 RVCPNDIDCDDDEKECG 13 RV P D+D DDDE+ECG Sbjct: 639 RVTPKDVDSDDDERECG 655 >ref|XP_009790421.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X2 [Nicotiana sylvestris] Length = 658 Score = 107 bits (267), Expect = 3e-21 Identities = 53/77 (68%), Positives = 61/77 (79%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPKKFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQN 64 VSLSWT EEE+RFKDM+RS A K W N+ LPSKTRE+LVSYYFNVFL++RRSYQN Sbjct: 552 VSLSWTSEEEERFKDMVRSSATSNNK-WKNSKKLLPSKTREKLVSYYFNVFLIRRRSYQN 610 Query: 63 RVCPNDIDCDDDEKECG 13 RV P ++D DDDE E G Sbjct: 611 RVTPKELDSDDDEIELG 627 >ref|XP_009790417.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X1 [Nicotiana sylvestris] gi|698487553|ref|XP_009790418.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X1 [Nicotiana sylvestris] gi|698487555|ref|XP_009790419.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X1 [Nicotiana sylvestris] gi|698487558|ref|XP_009790420.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X1 [Nicotiana sylvestris] Length = 659 Score = 107 bits (267), Expect = 3e-21 Identities = 53/77 (68%), Positives = 61/77 (79%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPKKFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQN 64 VSLSWT EEE+RFKDM+RS A K W N+ LPSKTRE+LVSYYFNVFL++RRSYQN Sbjct: 553 VSLSWTSEEEERFKDMVRSSATSNNK-WKNSKKLLPSKTREKLVSYYFNVFLIRRRSYQN 611 Query: 63 RVCPNDIDCDDDEKECG 13 RV P ++D DDDE E G Sbjct: 612 RVTPKELDSDDDEIELG 628 >ref|XP_009591217.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X2 [Nicotiana tomentosiformis] Length = 657 Score = 103 bits (257), Expect = 4e-20 Identities = 51/77 (66%), Positives = 59/77 (76%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPKKFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQN 64 VSLSWT EEE+RFKDM+RS + K W N+ LPSKTR LVSYYFNVFL++RRSYQN Sbjct: 551 VSLSWTAEEEERFKDMVRSSSTSNNK-WKNSKKLLPSKTRNMLVSYYFNVFLIRRRSYQN 609 Query: 63 RVCPNDIDCDDDEKECG 13 RV P ++D DDDE E G Sbjct: 610 RVTPKELDSDDDEIELG 626 >ref|XP_009591214.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X1 [Nicotiana tomentosiformis] gi|697164799|ref|XP_009591215.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X1 [Nicotiana tomentosiformis] gi|697164801|ref|XP_009591216.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X1 [Nicotiana tomentosiformis] Length = 658 Score = 103 bits (257), Expect = 4e-20 Identities = 51/77 (66%), Positives = 59/77 (76%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPKKFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQN 64 VSLSWT EEE+RFKDM+RS + K W N+ LPSKTR LVSYYFNVFL++RRSYQN Sbjct: 552 VSLSWTAEEEERFKDMVRSSSTSNNK-WKNSKKLLPSKTRNMLVSYYFNVFLIRRRSYQN 610 Query: 63 RVCPNDIDCDDDEKECG 13 RV P ++D DDDE E G Sbjct: 611 RVTPKELDSDDDEIELG 627 >gb|KHM99959.1| AT-rich interactive domain-containing protein 2 [Glycine soja] Length = 618 Score = 102 bits (254), Expect = 1e-19 Identities = 49/78 (62%), Positives = 56/78 (71%), Gaps = 1/78 (1%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPKK-FWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQ 67 VSL WT EEEKRFKD+M+S+ K FWNN + P KTR LVSYYFNVFL+Q R+YQ Sbjct: 510 VSLQWTTEEEKRFKDIMKSNIPSKNKYFWNNPSKYFPKKTRRNLVSYYFNVFLIQLRTYQ 569 Query: 66 NRVCPNDIDCDDDEKECG 13 NRV P +D DDDE E G Sbjct: 570 NRVSPKSVDSDDDEVEFG 587 >ref|XP_010275662.1| PREDICTED: AT-rich interactive domain-containing protein 2-like [Nelumbo nucifera] gi|720063501|ref|XP_010275663.1| PREDICTED: AT-rich interactive domain-containing protein 2-like [Nelumbo nucifera] Length = 607 Score = 100 bits (250), Expect = 3e-19 Identities = 50/78 (64%), Positives = 60/78 (76%), Gaps = 1/78 (1%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHA-AFPKKFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQ 67 VSLSWT+EEEKRFK ++R + + K FWN A P+K R+ LVSYYFNVFL++RRSYQ Sbjct: 495 VSLSWTEEEEKRFKTIVRLNPPSLDKCFWNQAFKSFPTKKRKDLVSYYFNVFLLRRRSYQ 554 Query: 66 NRVCPNDIDCDDDEKECG 13 NRV PN+ID DDDE E G Sbjct: 555 NRVSPNNIDSDDDESEFG 572 >ref|XP_008238928.1| PREDICTED: AT-rich interactive domain-containing protein 2 [Prunus mume] Length = 611 Score = 100 bits (250), Expect = 3e-19 Identities = 50/77 (64%), Positives = 57/77 (74%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPKKFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQN 64 VSL WT EEEKRFKD+++S++ FWN A + KTRE LVSYYFNVFLVQ RSYQN Sbjct: 508 VSLQWTAEEEKRFKDLVKSNSP---SFWNRASRWFRKKTRENLVSYYFNVFLVQSRSYQN 564 Query: 63 RVCPNDIDCDDDEKECG 13 RV P +ID DDDE E G Sbjct: 565 RVTPKNIDSDDDETEFG 581 >ref|XP_007208888.1| hypothetical protein PRUPE_ppa026661mg [Prunus persica] gi|462404623|gb|EMJ10087.1| hypothetical protein PRUPE_ppa026661mg [Prunus persica] Length = 610 Score = 100 bits (250), Expect = 3e-19 Identities = 50/77 (64%), Positives = 57/77 (74%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPKKFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQN 64 VSL WT EEEKRFKD+++S++ FWN A + KTRE LVSYYFNVFLVQ RSYQN Sbjct: 507 VSLQWTAEEEKRFKDLVKSNSP---SFWNRASRWFRKKTRENLVSYYFNVFLVQSRSYQN 563 Query: 63 RVCPNDIDCDDDEKECG 13 RV P +ID DDDE E G Sbjct: 564 RVTPKNIDSDDDETEFG 580 >ref|XP_003524452.1| PREDICTED: AT-rich interactive domain-containing protein 2-like isoform X1 [Glycine max] gi|571457054|ref|XP_006580567.1| PREDICTED: AT-rich interactive domain-containing protein 2-like isoform X2 [Glycine max] Length = 618 Score = 100 bits (250), Expect = 3e-19 Identities = 48/78 (61%), Positives = 55/78 (70%), Gaps = 1/78 (1%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPKK-FWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQ 67 VSL WT EEEKRFKD+M+S+ K FWNN + P KTR LVSYYFN FL+Q R+YQ Sbjct: 510 VSLQWTTEEEKRFKDIMKSNIPSKNKYFWNNPSKYFPKKTRRNLVSYYFNAFLIQLRTYQ 569 Query: 66 NRVCPNDIDCDDDEKECG 13 NRV P +D DDDE E G Sbjct: 570 NRVSPKSVDSDDDEVEFG 587 >ref|XP_003532418.1| PREDICTED: AT-rich interactive domain-containing protein 2-like [Glycine max] gi|734363744|gb|KHN16805.1| AT-rich interactive domain-containing protein 2 [Glycine soja] Length = 632 Score = 100 bits (249), Expect = 4e-19 Identities = 47/78 (60%), Positives = 57/78 (73%), Gaps = 1/78 (1%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPKK-FWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQ 67 VSL WT EEE+RFKD+M+S+ + K FWNN + P KTR LV+YYFNVFL+Q R+YQ Sbjct: 512 VSLQWTTEEEQRFKDIMKSNISSKNKYFWNNPSKYFPKKTRRNLVNYYFNVFLIQLRTYQ 571 Query: 66 NRVCPNDIDCDDDEKECG 13 NRV P +D DDDE E G Sbjct: 572 NRVTPESVDSDDDEVEFG 589 >ref|XP_010658131.1| PREDICTED: AT-rich interactive domain-containing protein 2 [Vitis vinifera] gi|731377664|ref|XP_010658136.1| PREDICTED: AT-rich interactive domain-containing protein 2 [Vitis vinifera] Length = 602 Score = 99.8 bits (247), Expect = 6e-19 Identities = 48/78 (61%), Positives = 58/78 (74%), Gaps = 1/78 (1%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPK-KFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQ 67 +SL+WT EEEKRFK M+R +++ FW+NA P+KTRE LVSYYFNVFL++RR YQ Sbjct: 494 ISLAWTTEEEKRFKHMIRLNSSLQSPSFWDNALRIFPTKTREALVSYYFNVFLIRRRIYQ 553 Query: 66 NRVCPNDIDCDDDEKECG 13 NRV P ID DDDE E G Sbjct: 554 NRVTPRKIDSDDDELEFG 571 >emb|CBI34361.3| unnamed protein product [Vitis vinifera] Length = 532 Score = 99.8 bits (247), Expect = 6e-19 Identities = 48/78 (61%), Positives = 58/78 (74%), Gaps = 1/78 (1%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPK-KFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQ 67 +SL+WT EEEKRFK M+R +++ FW+NA P+KTRE LVSYYFNVFL++RR YQ Sbjct: 424 ISLAWTTEEEKRFKHMIRLNSSLQSPSFWDNALRIFPTKTREALVSYYFNVFLIRRRIYQ 483 Query: 66 NRVCPNDIDCDDDEKECG 13 NRV P ID DDDE E G Sbjct: 484 NRVTPRKIDSDDDELEFG 501 >ref|XP_002298024.2| hypothetical protein POPTR_0001s09620g [Populus trichocarpa] gi|550346905|gb|EEE82829.2| hypothetical protein POPTR_0001s09620g [Populus trichocarpa] Length = 648 Score = 99.8 bits (247), Expect = 6e-19 Identities = 49/78 (62%), Positives = 58/78 (74%), Gaps = 1/78 (1%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPKK-FWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQ 67 VSL WT EEEKRFKDM++ + K FW+N + P KTRE+LVSYYFN +LV+RRSYQ Sbjct: 540 VSLRWTTEEEKRFKDMVKFNLLSAGKCFWDNKHKYFPRKTREELVSYYFNAYLVRRRSYQ 599 Query: 66 NRVCPNDIDCDDDEKECG 13 NRV P +ID DDDE E G Sbjct: 600 NRVTPKNIDSDDDETEFG 617 >emb|CAN60589.1| hypothetical protein VITISV_023124 [Vitis vinifera] Length = 258 Score = 99.8 bits (247), Expect = 6e-19 Identities = 48/78 (61%), Positives = 58/78 (74%), Gaps = 1/78 (1%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHAAFPK-KFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQ 67 +SL+WT EEEKRFK M+R +++ FW+NA P+KTRE LVSYYFNVFL++RR YQ Sbjct: 150 ISLAWTTEEEKRFKHMIRLNSSLQSPSFWDNALRIFPTKTREALVSYYFNVFLIRRRIYQ 209 Query: 66 NRVCPNDIDCDDDEKECG 13 NRV P ID DDDE E G Sbjct: 210 NRVTPRKIDSDDDELEFG 227 >ref|XP_012086862.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X2 [Jatropha curcas] Length = 623 Score = 99.4 bits (246), Expect = 8e-19 Identities = 48/78 (61%), Positives = 58/78 (74%), Gaps = 1/78 (1%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHA-AFPKKFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQ 67 +SL WT EEKRFKDM+R + + K FW+++ + P K +E+LVSYYFNVFLVQRRSYQ Sbjct: 514 ISLGWTAAEEKRFKDMVRFNPPSLDKCFWDDSRKYFPRKPKEELVSYYFNVFLVQRRSYQ 573 Query: 66 NRVCPNDIDCDDDEKECG 13 NRV P ID DDDE E G Sbjct: 574 NRVTPKQIDSDDDESEFG 591 >ref|XP_012086861.1| PREDICTED: AT-rich interactive domain-containing protein 2 isoform X1 [Jatropha curcas] gi|643711983|gb|KDP25411.1| hypothetical protein JCGZ_20567 [Jatropha curcas] Length = 628 Score = 99.4 bits (246), Expect = 8e-19 Identities = 48/78 (61%), Positives = 58/78 (74%), Gaps = 1/78 (1%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHA-AFPKKFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQ 67 +SL WT EEKRFKDM+R + + K FW+++ + P K +E+LVSYYFNVFLVQRRSYQ Sbjct: 519 ISLGWTAAEEKRFKDMVRFNPPSLDKCFWDDSRKYFPRKPKEELVSYYFNVFLVQRRSYQ 578 Query: 66 NRVCPNDIDCDDDEKECG 13 NRV P ID DDDE E G Sbjct: 579 NRVTPKQIDSDDDESEFG 596 >ref|XP_002509831.1| DNA binding protein, putative [Ricinus communis] gi|223549730|gb|EEF51218.1| DNA binding protein, putative [Ricinus communis] Length = 656 Score = 99.0 bits (245), Expect = 1e-18 Identities = 48/78 (61%), Positives = 59/78 (75%), Gaps = 1/78 (1%) Frame = -1 Query: 243 VSLSWTKEEEKRFKDMMRSHA-AFPKKFWNNACWFLPSKTREQLVSYYFNVFLVQRRSYQ 67 ++L WT EEEKRFKD++R + + K FW+N+ + KT+E+LVSYYFNVFLVQRRSYQ Sbjct: 548 IALRWTAEEEKRFKDVVRFNLPSLDKFFWDNSRKYFRRKTKEELVSYYFNVFLVQRRSYQ 607 Query: 66 NRVCPNDIDCDDDEKECG 13 NRV P ID DDDE E G Sbjct: 608 NRVTPKHIDSDDDESEFG 625