BLASTX nr result
ID: Forsythia22_contig00048071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00048071 (268 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089070.1| PREDICTED: ethylene-responsive transcription... 73 9e-11 ref|XP_011089069.1| PREDICTED: ethylene-responsive transcription... 71 2e-10 ref|XP_011089068.1| PREDICTED: ethylene-responsive transcription... 71 2e-10 ref|XP_010036790.1| PREDICTED: ethylene-responsive transcription... 70 6e-10 ref|XP_011089662.1| PREDICTED: ethylene-responsive transcription... 67 6e-09 ref|XP_011089071.1| PREDICTED: ethylene-responsive transcription... 66 1e-08 ref|XP_010326286.1| PREDICTED: ethylene-responsive transcription... 65 2e-08 ref|XP_004247071.1| PREDICTED: ethylene-responsive transcription... 65 2e-08 ref|XP_006340012.1| PREDICTED: ethylene-responsive transcription... 64 4e-08 ref|XP_009610259.1| PREDICTED: ethylene-responsive transcription... 64 5e-08 ref|XP_009610255.1| PREDICTED: ethylene-responsive transcription... 64 5e-08 ref|XP_009758063.1| PREDICTED: ethylene-responsive transcription... 62 2e-07 ref|XP_009758059.1| PREDICTED: ethylene-responsive transcription... 62 2e-07 gb|KJB08455.1| hypothetical protein B456_001G231300 [Gossypium r... 59 2e-06 ref|XP_012492539.1| PREDICTED: ethylene-responsive transcription... 59 2e-06 ref|XP_006479234.1| PREDICTED: ethylene-responsive transcription... 59 2e-06 ref|XP_006443556.1| hypothetical protein CICLE_v10021891mg [Citr... 59 2e-06 gb|KHG10243.1| hypothetical protein F383_14405 [Gossypium arboreum] 58 2e-06 ref|XP_010242670.1| PREDICTED: ethylene-responsive transcription... 58 2e-06 emb|CDP03907.1| unnamed protein product [Coffea canephora] 56 8e-06 >ref|XP_011089070.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X3 [Sesamum indicum] Length = 230 Score = 72.8 bits (177), Expect = 9e-11 Identities = 38/58 (65%), Positives = 46/58 (79%), Gaps = 1/58 (1%) Frame = -3 Query: 188 RNTETAMVSIRRRKLLGLCSGRNSSVAPLSKS-EHGHHTEIHVDNTKPVSVHPMVLDD 18 R ETAMVSIRRRKLLG+CSGR+S +APLS + EHGH E ++TK VSVHP+ L+D Sbjct: 2 REPETAMVSIRRRKLLGMCSGRSSFLAPLSCAFEHGHTPENCAESTKSVSVHPLPLND 59 >ref|XP_011089069.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X2 [Sesamum indicum] Length = 232 Score = 71.2 bits (173), Expect = 2e-10 Identities = 37/55 (67%), Positives = 45/55 (81%), Gaps = 1/55 (1%) Frame = -3 Query: 179 ETAMVSIRRRKLLGLCSGRNSSVAPLSKS-EHGHHTEIHVDNTKPVSVHPMVLDD 18 ETAMVSIRRRKLLG+CSGR+S +APLS + EHGH E ++TK VSVHP+ L+D Sbjct: 7 ETAMVSIRRRKLLGMCSGRSSFLAPLSCAFEHGHTPENCAESTKSVSVHPLPLND 61 >ref|XP_011089068.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Sesamum indicum] Length = 240 Score = 71.2 bits (173), Expect = 2e-10 Identities = 37/55 (67%), Positives = 45/55 (81%), Gaps = 1/55 (1%) Frame = -3 Query: 179 ETAMVSIRRRKLLGLCSGRNSSVAPLSKS-EHGHHTEIHVDNTKPVSVHPMVLDD 18 ETAMVSIRRRKLLG+CSGR+S +APLS + EHGH E ++TK VSVHP+ L+D Sbjct: 15 ETAMVSIRRRKLLGMCSGRSSFLAPLSCAFEHGHTPENCAESTKSVSVHPLPLND 69 >ref|XP_010036790.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Eucalyptus grandis] gi|702494664|ref|XP_010036791.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Eucalyptus grandis] gi|702494668|ref|XP_010036792.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Eucalyptus grandis] gi|702494673|ref|XP_010036793.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Eucalyptus grandis] gi|629081989|gb|KCW48434.1| hypothetical protein EUGRSUZ_K02136 [Eucalyptus grandis] Length = 230 Score = 70.1 bits (170), Expect = 6e-10 Identities = 33/56 (58%), Positives = 41/56 (73%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSKSEHGHHTEIHVDNTKPVSVHPMVLDDIDPPK 3 MVS+RRRKLLGLCSG+ S +APL KS GH + N K V+VHP+ LDD+ PP+ Sbjct: 1 MVSLRRRKLLGLCSGKASFLAPLPKSSDGHANDTPNQNAKLVTVHPLPLDDVKPPE 56 >ref|XP_011089662.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Sesamum indicum] gi|747084499|ref|XP_011089663.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Sesamum indicum] Length = 223 Score = 66.6 bits (161), Expect = 6e-09 Identities = 35/57 (61%), Positives = 44/57 (77%), Gaps = 1/57 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDIDPPK 3 MVSIRRR+LLGLCSG+NS +APLS+ E+GH E +++TKP SVHP+ L D PK Sbjct: 1 MVSIRRRRLLGLCSGQNSFLAPLSRVLENGHTPENSIEDTKPGSVHPLPLTDGYMPK 57 >ref|XP_011089071.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X4 [Sesamum indicum] gi|747083413|ref|XP_011089072.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X4 [Sesamum indicum] Length = 223 Score = 65.9 bits (159), Expect = 1e-08 Identities = 34/52 (65%), Positives = 42/52 (80%), Gaps = 1/52 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSKS-EHGHHTEIHVDNTKPVSVHPMVLDD 18 MVSIRRRKLLG+CSGR+S +APLS + EHGH E ++TK VSVHP+ L+D Sbjct: 1 MVSIRRRKLLGMCSGRSSFLAPLSCAFEHGHTPENCAESTKSVSVHPLPLND 52 >ref|XP_010326286.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Solanum lycopersicum] gi|723729916|ref|XP_010326287.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Solanum lycopersicum] Length = 243 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/57 (59%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDIDPPK 3 MVSIRRRKLLGLCSGR++ + PL K SE+GH E + +P SVHPM DID K Sbjct: 1 MVSIRRRKLLGLCSGRSAFLVPLPKFSENGHFAEHRFFSNRPTSVHPMPSTDIDESK 57 >ref|XP_004247071.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X2 [Solanum lycopersicum] Length = 238 Score = 64.7 bits (156), Expect = 2e-08 Identities = 34/57 (59%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDIDPPK 3 MVSIRRRKLLGLCSGR++ + PL K SE+GH E + +P SVHPM DID K Sbjct: 1 MVSIRRRKLLGLCSGRSAFLVPLPKFSENGHFAEHRFFSNRPTSVHPMPSTDIDESK 57 >ref|XP_006340012.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040-like isoform X1 [Solanum tuberosum] gi|565345890|ref|XP_006340013.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040-like isoform X2 [Solanum tuberosum] Length = 237 Score = 63.9 bits (154), Expect = 4e-08 Identities = 34/57 (59%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDIDPPK 3 MVSIRRRKLLGLCSGR++ + PL K S +GH E N +P SVHPM DID K Sbjct: 1 MVSIRRRKLLGLCSGRSAFLVPLPKFSGNGHFAEHRFFNNRPTSVHPMPSTDIDESK 57 >ref|XP_009610259.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X2 [Nicotiana tomentosiformis] Length = 239 Score = 63.5 bits (153), Expect = 5e-08 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDIDPPK 3 MVSIRRRKLLGLCSGR+S + PL K SE+GH E N K SVHPM DID K Sbjct: 1 MVSIRRRKLLGLCSGRSSFLVPLPKFSENGHIAENCFLNNKSTSVHPMPSTDIDESK 57 >ref|XP_009610255.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Nicotiana tomentosiformis] gi|697112754|ref|XP_009610256.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Nicotiana tomentosiformis] gi|697112756|ref|XP_009610257.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Nicotiana tomentosiformis] Length = 242 Score = 63.5 bits (153), Expect = 5e-08 Identities = 36/57 (63%), Positives = 39/57 (68%), Gaps = 1/57 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDIDPPK 3 MVSIRRRKLLGLCSGR+S + PL K SE+GH E N K SVHPM DID K Sbjct: 1 MVSIRRRKLLGLCSGRSSFLVPLPKFSENGHIAENCFLNNKSTSVHPMPSTDIDESK 57 >ref|XP_009758063.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X2 [Nicotiana sylvestris] Length = 240 Score = 61.6 bits (148), Expect = 2e-07 Identities = 35/57 (61%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDIDPPK 3 MVSIRRRKLLGLCSGR+S + PL K SE+GH E N K SVHPM D D K Sbjct: 1 MVSIRRRKLLGLCSGRSSFLVPLPKFSENGHIAENRFLNNKHTSVHPMPSTDNDESK 57 >ref|XP_009758059.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Nicotiana sylvestris] gi|698522486|ref|XP_009758060.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Nicotiana sylvestris] gi|698522488|ref|XP_009758061.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Nicotiana sylvestris] Length = 243 Score = 61.6 bits (148), Expect = 2e-07 Identities = 35/57 (61%), Positives = 38/57 (66%), Gaps = 1/57 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDIDPPK 3 MVSIRRRKLLGLCSGR+S + PL K SE+GH E N K SVHPM D D K Sbjct: 1 MVSIRRRKLLGLCSGRSSFLVPLPKFSENGHIAENRFLNNKHTSVHPMPSTDNDESK 57 >gb|KJB08455.1| hypothetical protein B456_001G231300 [Gossypium raimondii] Length = 147 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDID 12 MVS+RRRKLLGLCSG+NS + PL + +G+ E N K VSVHPM LD I+ Sbjct: 1 MVSLRRRKLLGLCSGKNSVLTPLPRFFGNGNALETSSQNAKSVSVHPMPLDSIN 54 >ref|XP_012492539.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Gossypium raimondii] gi|823127095|ref|XP_012492549.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Gossypium raimondii] gi|823127097|ref|XP_012492557.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Gossypium raimondii] gi|763740955|gb|KJB08454.1| hypothetical protein B456_001G231300 [Gossypium raimondii] gi|763740960|gb|KJB08459.1| hypothetical protein B456_001G231300 [Gossypium raimondii] gi|763740961|gb|KJB08460.1| hypothetical protein B456_001G231300 [Gossypium raimondii] gi|763740962|gb|KJB08461.1| hypothetical protein B456_001G231300 [Gossypium raimondii] gi|763740963|gb|KJB08462.1| hypothetical protein B456_001G231300 [Gossypium raimondii] Length = 209 Score = 58.5 bits (140), Expect = 2e-06 Identities = 31/54 (57%), Positives = 38/54 (70%), Gaps = 1/54 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDID 12 MVS+RRRKLLGLCSG+NS + PL + +G+ E N K VSVHPM LD I+ Sbjct: 1 MVSLRRRKLLGLCSGKNSVLTPLPRFFGNGNALETSSQNAKSVSVHPMPLDSIN 54 >ref|XP_006479234.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040-like isoform X1 [Citrus sinensis] Length = 272 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/53 (54%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDI 15 MVS+RRRKLLGLCSG++S VAPL + SE+G+ E N +P+S+ P LD++ Sbjct: 27 MVSLRRRKLLGLCSGKSSFVAPLPRTSENGNAPENSTQNIRPISLRPSSLDNV 79 >ref|XP_006443556.1| hypothetical protein CICLE_v10021891mg [Citrus clementina] gi|567902138|ref|XP_006443557.1| hypothetical protein CICLE_v10021891mg [Citrus clementina] gi|567902140|ref|XP_006443558.1| hypothetical protein CICLE_v10021891mg [Citrus clementina] gi|567902142|ref|XP_006443559.1| hypothetical protein CICLE_v10021891mg [Citrus clementina] gi|568851107|ref|XP_006479235.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040-like isoform X2 [Citrus sinensis] gi|568851109|ref|XP_006479236.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040-like isoform X3 [Citrus sinensis] gi|568851111|ref|XP_006479237.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040-like isoform X4 [Citrus sinensis] gi|568851113|ref|XP_006479238.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040-like isoform X5 [Citrus sinensis] gi|557545818|gb|ESR56796.1| hypothetical protein CICLE_v10021891mg [Citrus clementina] gi|557545819|gb|ESR56797.1| hypothetical protein CICLE_v10021891mg [Citrus clementina] gi|557545820|gb|ESR56798.1| hypothetical protein CICLE_v10021891mg [Citrus clementina] gi|557545821|gb|ESR56799.1| hypothetical protein CICLE_v10021891mg [Citrus clementina] gi|641847097|gb|KDO65978.1| hypothetical protein CISIN_1g025914mg [Citrus sinensis] gi|641847098|gb|KDO65979.1| hypothetical protein CISIN_1g025914mg [Citrus sinensis] gi|641847099|gb|KDO65980.1| hypothetical protein CISIN_1g025914mg [Citrus sinensis] Length = 246 Score = 58.5 bits (140), Expect = 2e-06 Identities = 29/53 (54%), Positives = 40/53 (75%), Gaps = 1/53 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDI 15 MVS+RRRKLLGLCSG++S VAPL + SE+G+ E N +P+S+ P LD++ Sbjct: 1 MVSLRRRKLLGLCSGKSSFVAPLPRTSENGNAPENSTQNIRPISLRPSSLDNV 53 >gb|KHG10243.1| hypothetical protein F383_14405 [Gossypium arboreum] Length = 188 Score = 58.2 bits (139), Expect = 2e-06 Identities = 30/54 (55%), Positives = 39/54 (72%), Gaps = 1/54 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDID 12 MVS+RRRKLLGLCSG+NS + PL + +G+ E N K VSVHP++LD I+ Sbjct: 1 MVSLRRRKLLGLCSGKNSVLTPLHRFFGNGNALETSSQNAKSVSVHPILLDSIN 54 >ref|XP_010242670.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Nelumbo nucifera] Length = 232 Score = 58.2 bits (139), Expect = 2e-06 Identities = 32/57 (56%), Positives = 40/57 (70%), Gaps = 1/57 (1%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGRNSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDIDPPK 3 MVS+RRRKLLGLCSGR+S + L K S++G+ +E + NTKP SV PM DD K Sbjct: 1 MVSLRRRKLLGLCSGRSSFLVQLPKFSDNGNASENPIQNTKPGSVVPMPSDDTSQAK 57 >emb|CDP03907.1| unnamed protein product [Coffea canephora] Length = 230 Score = 56.2 bits (134), Expect = 8e-06 Identities = 35/58 (60%), Positives = 41/58 (70%), Gaps = 2/58 (3%) Frame = -3 Query: 170 MVSIRRRKLLGLCSGR-NSSVAPLSK-SEHGHHTEIHVDNTKPVSVHPMVLDDIDPPK 3 MVSIRRRKLLG SGR N +APL K SE+G+ EI + NTKP SVHP+ D+D K Sbjct: 1 MVSIRRRKLLG--SGRCNPFLAPLPKFSENGYTPEIRMQNTKPFSVHPIPSIDVDETK 56