BLASTX nr result
ID: Forsythia22_contig00047954
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00047954 (202 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011094470.1| PREDICTED: uncharacterized protein LOC105174... 63 7e-08 >ref|XP_011094470.1| PREDICTED: uncharacterized protein LOC105174162 [Sesamum indicum] Length = 671 Score = 63.2 bits (152), Expect = 7e-08 Identities = 34/60 (56%), Positives = 40/60 (66%) Frame = -2 Query: 180 PAFGRIVEPWPKLGPKSIVFSDDEPLPTITADPNSMDSRDGLQSVDIKSIPERPAVAASE 1 P F R+ +P P FSDDEPL +TADP S+ S GLQ V IK++PERPAVAASE Sbjct: 103 PVFSRVSQPQFPSEPL-FQFSDDEPLIAVTADPTSLTSPVGLQKVTIKAVPERPAVAASE 161