BLASTX nr result
ID: Forsythia22_contig00047920
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00047920 (238 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AJS14423.1| ribosomal protein S4 [Ruellia breedlovei] 79 1e-12 ref|YP_009108219.1| ribosomal protein S4 [Boulardia latisquama] ... 79 1e-12 gb|ADM63590.1| ribosomal protein S4, partial (chloroplast) [Dial... 79 1e-12 ref|YP_009144629.1| ribosomal protein S4 (chloroplast) [Scutella... 77 3e-12 ref|YP_009115897.1| ribosomal protein S4 [Scrophularia takesimen... 77 3e-12 gb|AII17711.1| ribosomal protein S4, partial (chloroplast) [Vibu... 77 3e-12 gb|ADD12930.1| ribosomal protein S4 [Tetracera portobellensis] 77 3e-12 gb|ADD12928.1| ribosomal protein S4 [Tetracera oblongata] 77 3e-12 gb|ADD12923.1| ribosomal protein S4 [Pinzona coriacea] 77 3e-12 gb|ADD12918.1| ribosomal protein S4 [Hibbertia scandens] 77 3e-12 gb|ADD12904.1| ribosomal protein S4 [Hibbertia cuneiformis] 77 3e-12 gb|ADD12897.1| ribosomal protein S4 [Doliocarpus validus] 77 3e-12 gb|ADD12895.1| ribosomal protein S4 [Doliocarpus multiflorus] gi... 77 3e-12 gb|ADD12879.1| ribosomal protein S4 [Curatella americana] 77 3e-12 gb|ADD29916.1| ribosomal protein S4 (chloroplast) [Dillenia indica] 77 3e-12 gb|ADD29914.1| ribosomal protein S4 (chloroplast) [Antirrhinum m... 77 3e-12 ref|YP_003359361.1| ribosomal protein S4 (chloroplast) [Olea eur... 77 3e-12 ref|YP_008815939.1| ribosomal protein S4 (chloroplast) [Lindenbe... 77 3e-12 gb|AFV61816.1| ribosomal protein S4 (chloroplast) [Origanum vulg... 77 3e-12 ref|YP_007353917.1| ribosomal protein S4 (chloroplast) [Tectona ... 77 3e-12 >gb|AJS14423.1| ribosomal protein S4 [Ruellia breedlovei] Length = 201 Score = 79.0 bits (193), Expect = 1e-12 Identities = 40/43 (93%), Positives = 40/43 (93%) Frame = +2 Query: 110 TKARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 TKA SDLRNQS S KKSQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 26 TKAGSDLRNQSRSVKKSQYRIRLEEKQKLRFHYGLTERQLLKY 68 >ref|YP_009108219.1| ribosomal protein S4 [Boulardia latisquama] gi|700576293|emb|CDI06842.1| ribosomal protein S4 [Boulardia latisquama] Length = 203 Score = 79.0 bits (193), Expect = 1e-12 Identities = 39/42 (92%), Positives = 40/42 (95%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 KAR+DLRNQS S KKSQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 27 KARNDLRNQSHSGKKSQYRIRLEEKQKLRFHYGLTERQLLKY 68 >gb|ADM63590.1| ribosomal protein S4, partial (chloroplast) [Dialypetalum sp. Koopman et al. s.n.] Length = 173 Score = 79.0 bits (193), Expect = 1e-12 Identities = 38/42 (90%), Positives = 38/42 (90%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 K R D RNQS SWKKSQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 18 KDRKDRRNQSGSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 59 >ref|YP_009144629.1| ribosomal protein S4 (chloroplast) [Scutellaria baicalensis] gi|827345867|gb|AKJ77168.1| ribosomal protein S4 (chloroplast) [Scutellaria baicalensis] Length = 201 Score = 77.4 bits (189), Expect = 3e-12 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 KA SDLRNQS S KKSQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 27 KAGSDLRNQSRSGKKSQYRIRLEEKQKLRFHYGLTERQLLKY 68 >ref|YP_009115897.1| ribosomal protein S4 [Scrophularia takesimensis] gi|744673741|gb|AJD00726.1| ribosomal protein S4 [Scrophularia takesimensis] Length = 201 Score = 77.4 bits (189), Expect = 3e-12 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 KA SDLRNQS S KKSQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 27 KAGSDLRNQSRSGKKSQYRIRLEEKQKLRFHYGLTERQLLKY 68 >gb|AII17711.1| ribosomal protein S4, partial (chloroplast) [Viburnum lantanoides] gi|669214998|gb|AII17715.1| ribosomal protein S4, partial (chloroplast) [Viburnum opulus] Length = 201 Score = 77.4 bits (189), Expect = 3e-12 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 KA SDLRNQS S KKSQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 27 KAGSDLRNQSRSGKKSQYRIRLEEKQKLRFHYGLTERQLLKY 68 >gb|ADD12930.1| ribosomal protein S4 [Tetracera portobellensis] Length = 189 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 K RSDLRNQS S K+SQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 15 KTRSDLRNQSRSGKRSQYRIRLEEKQKLRFHYGLTERQLLKY 56 >gb|ADD12928.1| ribosomal protein S4 [Tetracera oblongata] Length = 182 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 K RSDLRNQS S K+SQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 8 KTRSDLRNQSRSGKRSQYRIRLEEKQKLRFHYGLTERQLLKY 49 >gb|ADD12923.1| ribosomal protein S4 [Pinzona coriacea] Length = 181 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 K RSDLRNQS S K+SQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 7 KTRSDLRNQSRSGKRSQYRIRLEEKQKLRFHYGLTERQLLKY 48 >gb|ADD12918.1| ribosomal protein S4 [Hibbertia scandens] Length = 189 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 K RSDLRNQS S K+SQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 15 KTRSDLRNQSRSGKRSQYRIRLEEKQKLRFHYGLTERQLLKY 56 >gb|ADD12904.1| ribosomal protein S4 [Hibbertia cuneiformis] Length = 189 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 K RSDLRNQS S K+SQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 15 KTRSDLRNQSRSGKRSQYRIRLEEKQKLRFHYGLTERQLLKY 56 >gb|ADD12897.1| ribosomal protein S4 [Doliocarpus validus] Length = 186 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 K RSDLRNQS S K+SQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 12 KTRSDLRNQSRSGKRSQYRIRLEEKQKLRFHYGLTERQLLKY 53 >gb|ADD12895.1| ribosomal protein S4 [Doliocarpus multiflorus] gi|289599891|gb|ADD12896.1| ribosomal protein S4 [Doliocarpus subandinus] Length = 182 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 K RSDLRNQS S K+SQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 8 KTRSDLRNQSRSGKRSQYRIRLEEKQKLRFHYGLTERQLLKY 49 >gb|ADD12879.1| ribosomal protein S4 [Curatella americana] Length = 189 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 K RSDLRNQS S K+SQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 15 KTRSDLRNQSRSGKRSQYRIRLEEKQKLRFHYGLTERQLLKY 56 >gb|ADD29916.1| ribosomal protein S4 (chloroplast) [Dillenia indica] Length = 201 Score = 77.4 bits (189), Expect = 3e-12 Identities = 38/42 (90%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 K RSDLRNQS S K+SQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 27 KTRSDLRNQSRSGKRSQYRIRLEEKQKLRFHYGLTERQLLKY 68 >gb|ADD29914.1| ribosomal protein S4 (chloroplast) [Antirrhinum majus] Length = 201 Score = 77.4 bits (189), Expect = 3e-12 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 KA SDLRNQS S KKSQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 27 KAGSDLRNQSRSGKKSQYRIRLEEKQKLRFHYGLTERQLLKY 68 >ref|YP_003359361.1| ribosomal protein S4 (chloroplast) [Olea europaea] gi|330850745|ref|YP_004376423.1| ribosomal protein S4 [Olea europaea subsp. europaea] gi|334700284|ref|YP_004563783.1| ribosomal protein S4 [Olea europaea subsp. cuspidata] gi|334701890|ref|YP_004564499.1| ribosomal protein S4 [Olea europaea subsp. maroccana] gi|731971833|ref|YP_009110604.1| ribosomal protein S4 (chloroplast) [Hesperelaea palmeri] gi|281428689|gb|ADA69928.1| ribosomal protein S4 (chloroplast) [Olea europaea] gi|291059255|gb|ADD72091.1| ribosomal protein S4 [Olea europaea] gi|328795435|emb|CBR30317.1| ribosomal protein S4 [Olea europaea subsp. europaea] gi|334084403|emb|CBR23832.1| ribosomal protein S4 [Olea europaea subsp. cuspidata] gi|334084489|emb|CBR24624.1| ribosomal protein S4 [Olea europaea subsp. europaea] gi|334084575|emb|CBR30408.1| ribosomal protein S4 [Olea europaea subsp. europaea] gi|334084866|emb|CBS29244.1| ribosomal protein S4 [Olea europaea subsp. maroccana] gi|334084952|emb|CBJ04300.1| ribosomal protein S4 [Olea europaea subsp. cuspidata] gi|334085038|emb|CBR23740.1| ribosomal protein S4 [Olea europaea subsp. cuspidata] gi|510934406|emb|CCQ09104.1| ribosomal protein S4 (chloroplast) [Olea europaea subsp. europaea] gi|725798288|emb|CED79764.1| ribosomal protein S4 (chloroplast) [Hesperelaea palmeri] Length = 201 Score = 77.4 bits (189), Expect = 3e-12 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 KA SDLRNQS S KKSQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 27 KAGSDLRNQSRSGKKSQYRIRLEEKQKLRFHYGLTERQLLKY 68 >ref|YP_008815939.1| ribosomal protein S4 (chloroplast) [Lindenbergia philippensis] gi|557136865|emb|CDI43920.1| ribosomal protein S4 (chloroplast) [Lindenbergia philippensis] Length = 201 Score = 77.4 bits (189), Expect = 3e-12 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 KA SDLRNQS S KKSQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 27 KAGSDLRNQSRSGKKSQYRIRLEEKQKLRFHYGLTERQLLKY 68 >gb|AFV61816.1| ribosomal protein S4 (chloroplast) [Origanum vulgare subsp. vulgare] Length = 201 Score = 77.4 bits (189), Expect = 3e-12 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 KA SDLRNQS S KKSQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 27 KAGSDLRNQSRSGKKSQYRIRLEEKQKLRFHYGLTERQLLKY 68 >ref|YP_007353917.1| ribosomal protein S4 (chloroplast) [Tectona grandis] gi|438687606|emb|CCP47132.1| ribosomal protein S4 (chloroplast) [Tectona grandis] gi|438688290|emb|CCP47221.1| ribosomal protein S4 (chloroplast) [Tectona grandis] gi|438688414|emb|CCP47310.1| ribosomal protein S4 (chloroplast) [Tectona grandis] Length = 201 Score = 77.4 bits (189), Expect = 3e-12 Identities = 39/42 (92%), Positives = 39/42 (92%) Frame = +2 Query: 113 KARSDLRNQSCSWKKSQYRIRLEEKQKLRFHYGLTERQLLKY 238 KA SDLRNQS S KKSQYRIRLEEKQKLRFHYGLTERQLLKY Sbjct: 27 KAGSDLRNQSRSGKKSQYRIRLEEKQKLRFHYGLTERQLLKY 68