BLASTX nr result
ID: Forsythia22_contig00047918
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00047918 (255 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012844805.1| PREDICTED: ubiquitin-like-specific protease ... 65 1e-08 ref|XP_012844804.1| PREDICTED: ubiquitin-like-specific protease ... 65 1e-08 ref|XP_012844803.1| PREDICTED: ubiquitin-like-specific protease ... 65 1e-08 ref|XP_011086554.1| PREDICTED: ubiquitin-like-specific protease ... 64 4e-08 ref|XP_006365213.1| PREDICTED: ubiquitin-like-specific protease ... 63 7e-08 ref|XP_006365212.1| PREDICTED: ubiquitin-like-specific protease ... 63 7e-08 ref|XP_006365211.1| PREDICTED: ubiquitin-like-specific protease ... 63 7e-08 ref|XP_006365210.1| PREDICTED: ubiquitin-like-specific protease ... 63 7e-08 ref|XP_010320591.1| PREDICTED: ubiquitin-like-specific protease ... 62 1e-07 ref|XP_010320590.1| PREDICTED: ubiquitin-like-specific protease ... 62 1e-07 ref|XP_010320589.1| PREDICTED: ubiquitin-like-specific protease ... 62 1e-07 ref|XP_010320588.1| PREDICTED: ubiquitin-like-specific protease ... 62 1e-07 ref|XP_009600338.1| PREDICTED: ubiquitin-like-specific protease ... 62 1e-07 ref|XP_009600333.1| PREDICTED: ubiquitin-like-specific protease ... 62 1e-07 ref|XP_009762757.1| PREDICTED: ubiquitin-like-specific protease ... 61 3e-07 ref|XP_009762756.1| PREDICTED: ubiquitin-like-specific protease ... 61 3e-07 ref|XP_010242981.1| PREDICTED: ubiquitin-like-specific protease ... 59 1e-06 ref|XP_010242980.1| PREDICTED: ubiquitin-like-specific protease ... 59 1e-06 ref|XP_010242979.1| PREDICTED: ubiquitin-like-specific protease ... 59 1e-06 ref|XP_010242978.1| PREDICTED: ubiquitin-like-specific protease ... 59 1e-06 >ref|XP_012844805.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X3 [Erythranthe guttatus] Length = 313 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRKV 128 IMNFYIRYLQK S +R DYHFFNTYFY K+K DVL K+ Sbjct: 88 IMNFYIRYLQKPTSPMGRKRCDYHFFNTYFYKKLKRDVLTKI 129 >ref|XP_012844804.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X2 [Erythranthe guttatus] Length = 321 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRKV 128 IMNFYIRYLQK S +R DYHFFNTYFY K+K DVL K+ Sbjct: 96 IMNFYIRYLQKPTSPMGRKRCDYHFFNTYFYKKLKRDVLTKI 137 >ref|XP_012844803.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X1 [Erythranthe guttatus] Length = 373 Score = 65.5 bits (158), Expect = 1e-08 Identities = 29/42 (69%), Positives = 32/42 (76%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRKV 128 IMNFYIRYLQK S +R DYHFFNTYFY K+K DVL K+ Sbjct: 148 IMNFYIRYLQKPTSPMGRKRCDYHFFNTYFYKKLKRDVLTKI 189 >ref|XP_011086554.1| PREDICTED: ubiquitin-like-specific protease 1D [Sesamum indicum] Length = 501 Score = 63.9 bits (154), Expect = 4e-08 Identities = 29/41 (70%), Positives = 30/41 (73%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRK 131 IMNFYIRYLQK S R DYHFFNTYFY K+K DVL K Sbjct: 278 IMNFYIRYLQKPTSPRARSRCDYHFFNTYFYEKLKRDVLNK 318 >ref|XP_006365213.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X4 [Solanum tuberosum] Length = 527 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRK 131 IMNFYIR+LQ+R S D ER DYHFFNTYFY+K+K V K Sbjct: 308 IMNFYIRHLQQRKSPADGERCDYHFFNTYFYSKLKEAVFSK 348 >ref|XP_006365212.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X3 [Solanum tuberosum] Length = 528 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRK 131 IMNFYIR+LQ+R S D ER DYHFFNTYFY+K+K V K Sbjct: 310 IMNFYIRHLQQRKSPADGERCDYHFFNTYFYSKLKEAVFSK 350 >ref|XP_006365211.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X2 [Solanum tuberosum] Length = 528 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRK 131 IMNFYIR+LQ+R S D ER DYHFFNTYFY+K+K V K Sbjct: 309 IMNFYIRHLQQRKSPADGERCDYHFFNTYFYSKLKEAVFSK 349 >ref|XP_006365210.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X1 [Solanum tuberosum] Length = 529 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/41 (68%), Positives = 32/41 (78%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRK 131 IMNFYIR+LQ+R S D ER DYHFFNTYFY+K+K V K Sbjct: 310 IMNFYIRHLQQRKSPADGERCDYHFFNTYFYSKLKEAVFSK 350 >ref|XP_010320591.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X4 [Solanum lycopersicum] Length = 527 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRK 131 IMNFYIR+LQ++ S D ER DYHFFNTYFY+K+K V K Sbjct: 308 IMNFYIRHLQQKKSPADGERCDYHFFNTYFYSKLKEAVFSK 348 >ref|XP_010320590.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X3 [Solanum lycopersicum] Length = 528 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRK 131 IMNFYIR+LQ++ S D ER DYHFFNTYFY+K+K V K Sbjct: 310 IMNFYIRHLQQKKSPADGERCDYHFFNTYFYSKLKEAVFSK 350 >ref|XP_010320589.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X2 [Solanum lycopersicum] Length = 528 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRK 131 IMNFYIR+LQ++ S D ER DYHFFNTYFY+K+K V K Sbjct: 309 IMNFYIRHLQQKKSPADGERCDYHFFNTYFYSKLKEAVFSK 349 >ref|XP_010320588.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X1 [Solanum lycopersicum] Length = 529 Score = 62.0 bits (149), Expect = 1e-07 Identities = 27/41 (65%), Positives = 32/41 (78%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRK 131 IMNFYIR+LQ++ S D ER DYHFFNTYFY+K+K V K Sbjct: 310 IMNFYIRHLQQKKSPADGERCDYHFFNTYFYSKLKEAVFSK 350 >ref|XP_009600338.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X2 [Nicotiana tomentosiformis] Length = 531 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRK 131 IMNFYIRYLQ+ S D ER YHFFNTYFYNK+K V K Sbjct: 313 IMNFYIRYLQQTKSLADGERCAYHFFNTYFYNKLKESVFSK 353 >ref|XP_009600333.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X1 [Nicotiana tomentosiformis] Length = 532 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRK 131 IMNFYIRYLQ+ S D ER YHFFNTYFYNK+K V K Sbjct: 313 IMNFYIRYLQQTKSLADGERCAYHFFNTYFYNKLKESVFSK 353 >ref|XP_009762757.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X2 [Nicotiana sylvestris] Length = 534 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRK 131 IMNFYIRYLQ+ S D ER YHFFNTYFYNK+K V K Sbjct: 316 IMNFYIRYLQQTKSLADGERCAYHFFNTYFYNKLKEAVFSK 356 >ref|XP_009762756.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X1 [Nicotiana sylvestris] Length = 535 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/41 (68%), Positives = 30/41 (73%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRK 131 IMNFYIRYLQ+ S D ER YHFFNTYFYNK+K V K Sbjct: 316 IMNFYIRYLQQTKSLADGERCAYHFFNTYFYNKLKEAVFSK 356 >ref|XP_010242981.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X7 [Nelumbo nucifera] Length = 532 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRKVS 125 IMNFYIRYLQ+ AS T R DYH FNTYFY K+K VL K S Sbjct: 345 IMNFYIRYLQRPASLTSRPRGDYHIFNTYFYKKLKDAVLCKKS 387 >ref|XP_010242980.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X6 [Nelumbo nucifera] Length = 546 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRKVS 125 IMNFYIRYLQ+ AS T R DYH FNTYFY K+K VL K S Sbjct: 345 IMNFYIRYLQRPASLTSRPRGDYHIFNTYFYKKLKDAVLCKKS 387 >ref|XP_010242979.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X5 [Nelumbo nucifera] Length = 571 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRKVS 125 IMNFYIRYLQ+ AS T R DYH FNTYFY K+K VL K S Sbjct: 313 IMNFYIRYLQRPASLTSRPRGDYHIFNTYFYKKLKDAVLCKKS 355 >ref|XP_010242978.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X4 [Nelumbo nucifera] Length = 574 Score = 59.3 bits (142), Expect = 1e-06 Identities = 29/43 (67%), Positives = 31/43 (72%) Frame = -3 Query: 253 IMNFYIRYLQKRASSTDTERLDYHFFNTYFYNKMKHDVLRKVS 125 IMNFYIRYLQ+ AS T R DYH FNTYFY K+K VL K S Sbjct: 316 IMNFYIRYLQRPASLTSRPRGDYHIFNTYFYKKLKDAVLCKKS 358