BLASTX nr result
ID: Forsythia22_contig00047854
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00047854 (302 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012843741.1| PREDICTED: U-box domain-containing protein 3... 62 2e-07 gb|EPS60472.1| hypothetical protein M569_14332, partial [Genlise... 60 6e-07 ref|XP_011092453.1| PREDICTED: U-box domain-containing protein 3... 59 2e-06 >ref|XP_012843741.1| PREDICTED: U-box domain-containing protein 33 [Erythranthe guttatus] gi|604321550|gb|EYU32126.1| hypothetical protein MIMGU_mgv1a001191mg [Erythranthe guttata] Length = 869 Score = 62.0 bits (149), Expect = 2e-07 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = +1 Query: 196 DDTIFVALGKDLKEGDTVLMWALHNSKGRKICIIH 300 DD +FVALGKD+KEG TVLMWALHNS+G+KI I+H Sbjct: 52 DDVMFVALGKDVKEGATVLMWALHNSRGKKIFILH 86 >gb|EPS60472.1| hypothetical protein M569_14332, partial [Genlisea aurea] Length = 125 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/35 (74%), Positives = 31/35 (88%) Frame = +1 Query: 196 DDTIFVALGKDLKEGDTVLMWALHNSKGRKICIIH 300 +D IFVALGKD+KE +VLMWALHNS G+KICI+H Sbjct: 5 EDVIFVALGKDVKECQSVLMWALHNSGGKKICILH 39 >ref|XP_011092453.1| PREDICTED: U-box domain-containing protein 33 [Sesamum indicum] Length = 889 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/48 (56%), Positives = 37/48 (77%), Gaps = 3/48 (6%) Frame = +1 Query: 166 DEIMARTPSP---DDTIFVALGKDLKEGDTVLMWALHNSKGRKICIIH 300 +E+ RT SP +D +FVALGKD+K+ +TVL WAL+NS+G ICI+H Sbjct: 39 EEVEPRTTSPPLKEDMMFVALGKDVKDSETVLAWALNNSRGMGICILH 86