BLASTX nr result
ID: Forsythia22_contig00047136
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00047136 (344 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011071373.1| PREDICTED: probable WRKY transcription facto... 57 4e-06 >ref|XP_011071373.1| PREDICTED: probable WRKY transcription factor 48 [Sesamum indicum] Length = 372 Score = 57.4 bits (137), Expect = 4e-06 Identities = 35/70 (50%), Positives = 43/70 (61%), Gaps = 12/70 (17%) Frame = -3 Query: 291 RPY-FHSLMTPPL---MKFSTNSISNS--------SFHQERTFRPSSSLVRDDGLLQDMV 148 +PY F +L+TPP + FST S + + S QER F PS+SL RD GLLQDM+ Sbjct: 302 QPYIFRNLITPPPPPPLSFSTTSTTTNPTFNPPAPSLFQERPFCPSTSLARDHGLLQDML 361 Query: 147 PPQMLKDSKE 118 P QM KD KE Sbjct: 362 PSQMFKDPKE 371