BLASTX nr result
ID: Forsythia22_contig00045732
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00045732 (282 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI31112.3| unnamed protein product [Vitis vinifera] 62 1e-07 ref|XP_011101780.1| PREDICTED: LOW QUALITY PROTEIN: putative ATP... 57 5e-07 >emb|CBI31112.3| unnamed protein product [Vitis vinifera] Length = 2099 Score = 62.0 bits (149), Expect = 1e-07 Identities = 30/32 (93%), Positives = 30/32 (93%) Frame = -1 Query: 180 FFTTRTGLTELSCLEGIISS*SRMPQLDKFTY 85 FFTTRTGLTELSCLEGII S SRMPQLDKFTY Sbjct: 1918 FFTTRTGLTELSCLEGIIFSQSRMPQLDKFTY 1949 >ref|XP_011101780.1| PREDICTED: LOW QUALITY PROTEIN: putative ATP synthase protein YMF19 [Sesamum indicum] Length = 196 Score = 57.0 bits (136), Expect(2) = 5e-07 Identities = 28/32 (87%), Positives = 28/32 (87%) Frame = -1 Query: 180 FFTTRTGLTELSCLEGIISS*SRMPQLDKFTY 85 FFTTRT LTELSCLEGII S S MPQLDKFTY Sbjct: 15 FFTTRTDLTELSCLEGIIGSQSIMPQLDKFTY 46 Score = 23.1 bits (48), Expect(2) = 5e-07 Identities = 10/12 (83%), Positives = 10/12 (83%) Frame = -2 Query: 221 MLSVGQQPTKVL 186 MLSVGQQPT L Sbjct: 1 MLSVGQQPTAAL 12