BLASTX nr result
ID: Forsythia22_contig00045427
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00045427 (281 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU26683.1| hypothetical protein MIMGU_mgv1a025461mg, partial... 62 1e-07 >gb|EYU26683.1| hypothetical protein MIMGU_mgv1a025461mg, partial [Erythranthe guttata] Length = 162 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/52 (65%), Positives = 39/52 (75%), Gaps = 4/52 (7%) Frame = +1 Query: 136 AGLDAATISSLPMFSYGS-SANNNKNSSPE---SECAICLSMFQQGENVKVL 279 AGLD ATI SLP+FSYGS S NK PE ++CAICLSMFQ+G+ VKVL Sbjct: 71 AGLDPATIGSLPIFSYGSTSCCKNKKPIPEPAEADCAICLSMFQEGDKVKVL 122