BLASTX nr result
ID: Forsythia22_contig00045364
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00045364 (630 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011074107.1| PREDICTED: type I inositol 1,4,5-trisphospha... 63 1e-07 emb|CDP11453.1| unnamed protein product [Coffea canephora] 63 1e-07 ref|XP_011100648.1| PREDICTED: type I inositol 1,4,5-trisphospha... 61 4e-07 ref|XP_011100644.1| PREDICTED: type I inositol 1,4,5-trisphospha... 61 4e-07 ref|XP_012838943.1| PREDICTED: type I inositol 1,4,5-trisphospha... 61 5e-07 ref|XP_012838942.1| PREDICTED: type I inositol 1,4,5-trisphospha... 61 5e-07 ref|XP_012852908.1| PREDICTED: type I inositol 1,4,5-trisphospha... 60 7e-07 gb|EYU24336.1| hypothetical protein MIMGU_mgv1a002896mg [Erythra... 60 7e-07 ref|XP_009764112.1| PREDICTED: type I inositol 1,4,5-trisphospha... 60 9e-07 ref|XP_009764110.1| PREDICTED: type I inositol 1,4,5-trisphospha... 60 9e-07 ref|XP_009764109.1| PREDICTED: type I inositol 1,4,5-trisphospha... 60 9e-07 ref|XP_009590095.1| PREDICTED: type I inositol 1,4,5-trisphospha... 60 9e-07 ref|XP_009590088.1| PREDICTED: type I inositol 1,4,5-trisphospha... 60 9e-07 ref|XP_009590080.1| PREDICTED: type I inositol 1,4,5-trisphospha... 60 9e-07 ref|XP_010314903.1| PREDICTED: inositol-1,4,5-triphosphate-5-pho... 59 2e-06 ref|XP_010314902.1| PREDICTED: inositol-1,4,5-triphosphate-5-pho... 59 2e-06 ref|XP_006359029.1| PREDICTED: type I inositol 1,4,5-trisphospha... 59 2e-06 ref|NP_001234795.1| inositol-1,4,5-triphosphate-5-phosphatase [S... 59 2e-06 gb|KDO83828.1| hypothetical protein CISIN_1g006204mg [Citrus sin... 59 3e-06 gb|KDO83827.1| hypothetical protein CISIN_1g006204mg [Citrus sin... 59 3e-06 >ref|XP_011074107.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like [Sesamum indicum] Length = 646 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKE 99 HRPV+ASYMVEVEVFSPKKLQRALT TDAEI+E Sbjct: 587 HRPVTASYMVEVEVFSPKKLQRALTFTDAEIEE 619 >emb|CDP11453.1| unnamed protein product [Coffea canephora] Length = 699 Score = 62.8 bits (151), Expect = 1e-07 Identities = 30/33 (90%), Positives = 32/33 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKE 99 HRPV+ASYMVEVEVFSPKKLQRALT TDAEI+E Sbjct: 640 HRPVTASYMVEVEVFSPKKLQRALTFTDAEIEE 672 >ref|XP_011100648.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like isoform X2 [Sesamum indicum] Length = 649 Score = 61.2 bits (147), Expect = 4e-07 Identities = 33/52 (63%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKE-GTL**MEIGSDLSH*RSG 153 HRPV+ASYMVEVEVFSP++LQRALT TDAEI+E + M +G + RSG Sbjct: 590 HRPVTASYMVEVEVFSPRRLQRALTFTDAEIEEQDIVTEMGLGGGIGRLRSG 641 >ref|XP_011100644.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like isoform X1 [Sesamum indicum] gi|747046648|ref|XP_011100647.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like isoform X1 [Sesamum indicum] Length = 664 Score = 61.2 bits (147), Expect = 4e-07 Identities = 33/52 (63%), Positives = 40/52 (76%), Gaps = 1/52 (1%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKE-GTL**MEIGSDLSH*RSG 153 HRPV+ASYMVEVEVFSP++LQRALT TDAEI+E + M +G + RSG Sbjct: 605 HRPVTASYMVEVEVFSPRRLQRALTFTDAEIEEQDIVTEMGLGGGIGRLRSG 656 >ref|XP_012838943.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like isoform X2 [Erythranthe guttatus] Length = 651 Score = 60.8 bits (146), Expect = 5e-07 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKEGTL 108 HRPV+ASYMVEVEVFSPKKLQRAL TDAEI+E L Sbjct: 604 HRPVTASYMVEVEVFSPKKLQRALIFTDAEIEEHDL 639 >ref|XP_012838942.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like isoform X1 [Erythranthe guttatus] gi|604331694|gb|EYU36552.1| hypothetical protein MIMGU_mgv1a002595mg [Erythranthe guttata] Length = 656 Score = 60.8 bits (146), Expect = 5e-07 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKEGTL 108 HRPV+ASYMVEVEVFSPKKLQRAL TDAEI+E L Sbjct: 604 HRPVTASYMVEVEVFSPKKLQRALIFTDAEIEEHDL 639 >ref|XP_012852908.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like [Erythranthe guttatus] Length = 692 Score = 60.5 bits (145), Expect = 7e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKE 99 HRPV+ASY+VEVEVFSP+KLQRALT TDAEI+E Sbjct: 648 HRPVTASYLVEVEVFSPRKLQRALTFTDAEIEE 680 >gb|EYU24336.1| hypothetical protein MIMGU_mgv1a002896mg [Erythranthe guttata] Length = 627 Score = 60.5 bits (145), Expect = 7e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKE 99 HRPV+ASY+VEVEVFSP+KLQRALT TDAEI+E Sbjct: 583 HRPVTASYLVEVEVFSPRKLQRALTFTDAEIEE 615 >ref|XP_009764112.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1 isoform X3 [Nicotiana sylvestris] Length = 624 Score = 60.1 bits (144), Expect = 9e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKE 99 HRPVSA+YMVEVEVFSP+KLQRALT TDAEI++ Sbjct: 565 HRPVSATYMVEVEVFSPRKLQRALTFTDAEIEK 597 >ref|XP_009764110.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1 isoform X2 [Nicotiana sylvestris] gi|698535207|ref|XP_009764111.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1 isoform X2 [Nicotiana sylvestris] Length = 643 Score = 60.1 bits (144), Expect = 9e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKE 99 HRPVSA+YMVEVEVFSP+KLQRALT TDAEI++ Sbjct: 584 HRPVSATYMVEVEVFSPRKLQRALTFTDAEIEK 616 >ref|XP_009764109.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1 isoform X1 [Nicotiana sylvestris] Length = 658 Score = 60.1 bits (144), Expect = 9e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKE 99 HRPVSA+YMVEVEVFSP+KLQRALT TDAEI++ Sbjct: 599 HRPVSATYMVEVEVFSPRKLQRALTFTDAEIEK 631 >ref|XP_009590095.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1 isoform X3 [Nicotiana tomentosiformis] Length = 534 Score = 60.1 bits (144), Expect = 9e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKE 99 HRPVSA+YMVEVEVFSP+KLQRALT TDAEI++ Sbjct: 475 HRPVSATYMVEVEVFSPRKLQRALTFTDAEIEK 507 >ref|XP_009590088.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1 isoform X2 [Nicotiana tomentosiformis] Length = 651 Score = 60.1 bits (144), Expect = 9e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKE 99 HRPVSA+YMVEVEVFSP+KLQRALT TDAEI++ Sbjct: 592 HRPVSATYMVEVEVFSPRKLQRALTFTDAEIEK 624 >ref|XP_009590080.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1 isoform X1 [Nicotiana tomentosiformis] Length = 666 Score = 60.1 bits (144), Expect = 9e-07 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIKE 99 HRPVSA+YMVEVEVFSP+KLQRALT TDAEI++ Sbjct: 607 HRPVSATYMVEVEVFSPRKLQRALTFTDAEIEK 639 >ref|XP_010314903.1| PREDICTED: inositol-1,4,5-triphosphate-5-phosphatase isoform X1 [Solanum lycopersicum] Length = 652 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEI 93 HRPVSA+YMVEVEVFSP+KLQRALT TDAEI Sbjct: 593 HRPVSATYMVEVEVFSPRKLQRALTFTDAEI 623 >ref|XP_010314902.1| PREDICTED: inositol-1,4,5-triphosphate-5-phosphatase isoform X2 [Solanum lycopersicum] Length = 667 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEI 93 HRPVSA+YMVEVEVFSP+KLQRALT TDAEI Sbjct: 608 HRPVSATYMVEVEVFSPRKLQRALTFTDAEI 638 >ref|XP_006359029.1| PREDICTED: type I inositol 1,4,5-trisphosphate 5-phosphatase 1-like [Solanum tuberosum] Length = 652 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEI 93 HRPVSA+YMVEVEVFSP+KLQRALT TDAEI Sbjct: 593 HRPVSATYMVEVEVFSPRKLQRALTFTDAEI 623 >ref|NP_001234795.1| inositol-1,4,5-triphosphate-5-phosphatase [Solanum lycopersicum] gi|157863710|gb|ABV90876.1| inositol-1,4,5-triphosphate-5-phosphatase [Solanum lycopersicum] Length = 652 Score = 59.3 bits (142), Expect = 2e-06 Identities = 28/31 (90%), Positives = 30/31 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEI 93 HRPVSA+YMVEVEVFSP+KLQRALT TDAEI Sbjct: 593 HRPVSATYMVEVEVFSPRKLQRALTFTDAEI 623 >gb|KDO83828.1| hypothetical protein CISIN_1g006204mg [Citrus sinensis] Length = 651 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIK 96 HRPV+A+YM EVEVFSP+KLQRALTLTDAEI+ Sbjct: 592 HRPVTATYMAEVEVFSPRKLQRALTLTDAEIE 623 >gb|KDO83827.1| hypothetical protein CISIN_1g006204mg [Citrus sinensis] Length = 412 Score = 58.5 bits (140), Expect = 3e-06 Identities = 27/32 (84%), Positives = 31/32 (96%) Frame = +1 Query: 1 HRPVSASYMVEVEVFSPKKLQRALTLTDAEIK 96 HRPV+A+YM EVEVFSP+KLQRALTLTDAEI+ Sbjct: 358 HRPVTATYMAEVEVFSPRKLQRALTLTDAEIE 389