BLASTX nr result
ID: Forsythia22_contig00043930
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00043930 (444 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011034400.1| PREDICTED: disease resistance RPP13-like pro... 57 4e-06 >ref|XP_011034400.1| PREDICTED: disease resistance RPP13-like protein 4 [Populus euphratica] gi|743873434|ref|XP_011034401.1| PREDICTED: disease resistance RPP13-like protein 4 [Populus euphratica] Length = 560 Score = 57.4 bits (137), Expect = 4e-06 Identities = 35/75 (46%), Positives = 42/75 (56%), Gaps = 6/75 (8%) Frame = -2 Query: 443 SEYHGLDDQKVKIENLLCESVGN------KAIGIVGMGGSGKSALARKVIFSSSVELLFE 282 SE G +D +IEN+L E++ N K IGI GMGG+GKS LA KV S V F Sbjct: 138 SEIPGFNDNIKEIENMLFENISNENGAEFKIIGIWGMGGTGKSTLASKVFNSEKVSSQFS 197 Query: 281 LILWIDLSKAMGSEK 237 +WI LS G EK Sbjct: 198 RKIWICLSGIHGGEK 212