BLASTX nr result
ID: Forsythia22_contig00043884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00043884 (338 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006491308.1| PREDICTED: uncharacterized protein LOC102630... 59 1e-06 >ref|XP_006491308.1| PREDICTED: uncharacterized protein LOC102630309 [Citrus sinensis] Length = 50 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/40 (60%), Positives = 34/40 (85%) Frame = +2 Query: 59 QHRKGRLWVPRCKILKEKRARLFIIRQCLYLLLCWREHED 178 + R G++ V R +IL+EKRARL+IIR+C+ +LLCWR+HED Sbjct: 10 RRRSGKVQVSRTRILEEKRARLYIIRRCVLMLLCWRDHED 49