BLASTX nr result
ID: Forsythia22_contig00043855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00043855 (553 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012837992.1| PREDICTED: protein argonaute MEL1 [Erythrant... 40 1e-06 ref|XP_011088815.1| PREDICTED: protein argonaute MEL1 [Sesamum i... 40 1e-06 >ref|XP_012837992.1| PREDICTED: protein argonaute MEL1 [Erythranthe guttatus] gi|604332267|gb|EYU37000.1| hypothetical protein MIMGU_mgv1a000822mg [Erythranthe guttata] Length = 971 Score = 40.0 bits (92), Expect(2) = 1e-06 Identities = 18/32 (56%), Positives = 22/32 (68%) Frame = -1 Query: 181 PHETIQAFNVILRKKPSINYEVVRRPFISPHF 86 P ETIQ +V+LR+KPS +YE V R F P F Sbjct: 252 PQETIQFLDVVLREKPSNSYEAVGRSFFHPEF 283 Score = 38.9 bits (89), Expect(2) = 1e-06 Identities = 18/41 (43%), Positives = 28/41 (68%) Frame = -3 Query: 326 YKNEDFFVKLVDKYGARTKHEFNVSIKFATTAYSSHIK*FI 204 + ++DF +KL + G+R + EF VSIKFA+ A H+K F+ Sbjct: 204 FASKDFVIKLDEDSGSRREREFKVSIKFASKADLYHLKEFL 244 >ref|XP_011088815.1| PREDICTED: protein argonaute MEL1 [Sesamum indicum] Length = 807 Score = 40.4 bits (93), Expect(2) = 1e-06 Identities = 19/35 (54%), Positives = 24/35 (68%) Frame = -1 Query: 196 RLFNDPHETIQAFNVILRKKPSINYEVVRRPFISP 92 R + P ET+Q +V+LR KPS +YEVV R F SP Sbjct: 78 RQLDFPQETLQCLDVVLRVKPSNSYEVVGRSFFSP 112 Score = 38.5 bits (88), Expect(2) = 1e-06 Identities = 21/42 (50%), Positives = 28/42 (66%), Gaps = 1/42 (2%) Frame = -3 Query: 326 YKNEDFFVKLVDKYG-ARTKHEFNVSIKFATTAYSSHIK*FI 204 + ++DF VKLVD+ AR + EF VSIKFA A H+K F+ Sbjct: 34 FSSKDFVVKLVDQDSQARREREFKVSIKFAAKADLHHLKQFL 75