BLASTX nr result
ID: Forsythia22_contig00043658
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00043658 (409 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ERM98834.1| hypothetical protein AMTR_s00093p00169580 [Ambore... 68 3e-09 gb|ERM97418.1| hypothetical protein AMTR_s00251p00013890 [Ambore... 63 3e-08 ref|NP_064043.1| orf112a gene product (mitochondrion) [Beta vulg... 60 7e-07 gb|ERN18203.1| hypothetical protein AMTR_s00054p00223760, partia... 59 2e-06 >gb|ERM98834.1| hypothetical protein AMTR_s00093p00169580 [Amborella trichopoda] Length = 131 Score = 67.8 bits (164), Expect = 3e-09 Identities = 45/76 (59%), Positives = 48/76 (63%), Gaps = 7/76 (9%) Frame = +2 Query: 191 VTFVT*CYVHAVIFYLSKSTTLYVVYVWGAYLTGDREVPHFDSRPVSISDPRSRD----- 355 VT VT CYVHAVI L KS T YVV VWG REVP F+S PVSISDPRSR Sbjct: 26 VTLVTFCYVHAVILSLPKSITPYVVAVWGDRC--GREVPQFNSHPVSISDPRSRITRLGL 83 Query: 356 YSVRSE--AGR*WTYL 397 + VRS+ AG TYL Sbjct: 84 FFVRSQQVAGNGPTYL 99 >gb|ERM97418.1| hypothetical protein AMTR_s00251p00013890 [Amborella trichopoda] Length = 111 Score = 62.8 bits (151), Expect(2) = 3e-08 Identities = 29/41 (70%), Positives = 33/41 (80%) Frame = -1 Query: 184 GIDHSSKYSKAENCCSLERRSAEVVPIIEVRVWD*AFRMRK 62 GIDH S++SKAENCCSLER S E +P EVRVWD AF+M K Sbjct: 55 GIDHYSQFSKAENCCSLERLSVEGIPTTEVRVWDWAFQMIK 95 Score = 21.6 bits (44), Expect(2) = 3e-08 Identities = 10/17 (58%), Positives = 12/17 (70%) Frame = -3 Query: 65 KEKKCLVSLEKPTQISY 15 K +K VSL +P QISY Sbjct: 95 KTQKFFVSLIEPMQISY 111 >ref|NP_064043.1| orf112a gene product (mitochondrion) [Beta vulgaris subsp. vulgaris] gi|9049343|dbj|BAA99353.1| orf112a (mitochondrion) [Beta vulgaris subsp. vulgaris] Length = 112 Score = 59.7 bits (143), Expect = 7e-07 Identities = 34/64 (53%), Positives = 41/64 (64%), Gaps = 7/64 (10%) Frame = -1 Query: 388 PLPAGF---GPNGVIP*SR----IGDANRAGIEVGDLSIACQVCSPDIDYVQGSTLGKIE 230 P+PAG NG+IP G ++ G + +SI+CQVC PDIDYVQGSTLGKIE Sbjct: 49 PIPAGSLTEKTNGLIPYLESEMLTGRESKWGTSLPPVSISCQVCFPDIDYVQGSTLGKIE 108 Query: 229 YHRV 218 HRV Sbjct: 109 SHRV 112 >gb|ERN18203.1| hypothetical protein AMTR_s00054p00223760, partial [Amborella trichopoda] Length = 67 Score = 58.5 bits (140), Expect = 2e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -1 Query: 181 IDHSSKYSKAENCCSLERRSAEVVPIIEVRVWD 83 IDH S++SKAENCCSLE RSA+VVP I+VRVWD Sbjct: 35 IDHYSQFSKAENCCSLECRSAKVVPTIDVRVWD 67