BLASTX nr result
ID: Forsythia22_contig00043609
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00043609 (264 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_009614249.1| PREDICTED: uncharacterized protein LOC104107... 57 6e-06 >ref|XP_009614249.1| PREDICTED: uncharacterized protein LOC104107218 [Nicotiana tomentosiformis] Length = 170 Score = 56.6 bits (135), Expect = 6e-06 Identities = 23/49 (46%), Positives = 34/49 (69%) Frame = +3 Query: 27 YKTVLRPTKFYGIDC*PIQP*YIYKMIIT*LVLLRWMCNHTTMD*IKNK 173 YK V+RPT YG++C P + Y+ +M + + +LRWMC HT +D I+NK Sbjct: 101 YKVVVRPTILYGVECWPFKNSYVQQMKVAEMGILRWMCEHTRLDRIRNK 149