BLASTX nr result
ID: Forsythia22_contig00043552
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00043552 (305 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010065718.1| PREDICTED: pentatricopeptide repeat-containi... 42 1e-06 ref|XP_012441679.1| PREDICTED: pentatricopeptide repeat-containi... 40 7e-06 emb|CDP17813.1| unnamed protein product [Coffea canephora] 41 7e-06 ref|XP_006577074.1| PREDICTED: pentatricopeptide repeat-containi... 42 9e-06 gb|KHN18774.1| Pentatricopeptide repeat-containing protein [Glyc... 42 9e-06 >ref|XP_010065718.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Eucalyptus grandis] gi|629097574|gb|KCW63339.1| hypothetical protein EUGRSUZ_G00971 [Eucalyptus grandis] Length = 539 Score = 41.6 bits (96), Expect(2) = 1e-06 Identities = 21/35 (60%), Positives = 24/35 (68%) Frame = +1 Query: 58 EENNFRLLASSEGLDPDSMTYRILVSG**RTEGRR 162 E N RLLA S+GL+PD M YRILVSG R R+ Sbjct: 466 EANKLRLLAQSKGLEPDGMMYRILVSGFTRERKRK 500 Score = 37.0 bits (84), Expect(2) = 1e-06 Identities = 15/36 (41%), Positives = 27/36 (75%), Gaps = 1/36 (2%) Frame = +3 Query: 150 RREEGEVMLEDRIG-GFIPDITAYNLLTDGLNKTKI 254 +R+EG++++++ + FIPD+ YN L DGL+ +KI Sbjct: 498 KRKEGQILVDEMLDKDFIPDLATYNRLIDGLSNSKI 533 >ref|XP_012441679.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240 [Gossypium raimondii] gi|763795143|gb|KJB62139.1| hypothetical protein B456_009G402600 [Gossypium raimondii] Length = 492 Score = 40.4 bits (93), Expect(2) = 7e-06 Identities = 21/35 (60%), Positives = 27/35 (77%) Frame = +1 Query: 58 EENNFRLLASSEGLDPDSMTYRILVSG**RTEGRR 162 + N FRLLAS++GL+PD +TY ILV G R +GRR Sbjct: 414 DANKFRLLASAKGLEPDEVTYNILVYGYTR-DGRR 447 Score = 35.8 bits (81), Expect(2) = 7e-06 Identities = 16/34 (47%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = +3 Query: 150 RREEGEVMLEDRIG-GFIPDITAYNLLTDGLNKT 248 RR+EGE ++++ + G+IPDI YN L DGL+ + Sbjct: 446 RRKEGENLVDEMLDKGYIPDIATYNRLMDGLSNS 479 >emb|CDP17813.1| unnamed protein product [Coffea canephora] Length = 479 Score = 41.2 bits (95), Expect(2) = 7e-06 Identities = 18/27 (66%), Positives = 21/27 (77%) Frame = +1 Query: 58 EENNFRLLASSEGLDPDSMTYRILVSG 138 E N RLLA+ +GLDPD TYRIL+SG Sbjct: 411 EANKLRLLAAGKGLDPDGTTYRILISG 437 Score = 35.0 bits (79), Expect(2) = 7e-06 Identities = 17/35 (48%), Positives = 23/35 (65%), Gaps = 1/35 (2%) Frame = +3 Query: 150 RREEGEVMLEDRI-GGFIPDITAYNLLTDGLNKTK 251 + EEGE ++E+ + G IPDI YN L GL+K K Sbjct: 443 KEEEGEALVEEMLDSGLIPDIATYNKLKLGLSKRK 477 >ref|XP_006577074.1| PREDICTED: pentatricopeptide repeat-containing protein At2g36240-like [Glycine max] Length = 477 Score = 41.6 bits (96), Expect(2) = 9e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +1 Query: 58 EENNFRLLASSEGLDPDSMTYRILVSG 138 E N RLLASS+G +PD MTYRILV G Sbjct: 399 EANRLRLLASSKGFEPDEMTYRILVMG 425 Score = 34.3 bits (77), Expect(2) = 9e-06 Identities = 14/34 (41%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = +3 Query: 153 REEGEVMLEDRIG-GFIPDITAYNLLTDGLNKTK 251 RE+GE+++++ + GFIPD+ +YN L GL+ + Sbjct: 432 REQGELLVDEMLDMGFIPDLASYNQLMSGLSNCR 465 >gb|KHN18774.1| Pentatricopeptide repeat-containing protein [Glycine soja] Length = 336 Score = 41.6 bits (96), Expect(2) = 9e-06 Identities = 19/27 (70%), Positives = 21/27 (77%) Frame = +1 Query: 58 EENNFRLLASSEGLDPDSMTYRILVSG 138 E N RLLASS+G +PD MTYRILV G Sbjct: 168 EANRLRLLASSKGFEPDEMTYRILVMG 194 Score = 34.3 bits (77), Expect(2) = 9e-06 Identities = 14/34 (41%), Positives = 25/34 (73%), Gaps = 1/34 (2%) Frame = +3 Query: 153 REEGEVMLEDRIG-GFIPDITAYNLLTDGLNKTK 251 RE+GE+++++ + GFIPD+ +YN L GL+ + Sbjct: 201 REQGELLVDEMLDMGFIPDLASYNQLMSGLSNCR 234