BLASTX nr result
ID: Forsythia22_contig00042684
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00042684 (338 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011624524.1| PREDICTED: AP-1 complex subunit mu-2 isoform... 57 6e-06 >ref|XP_011624524.1| PREDICTED: AP-1 complex subunit mu-2 isoform X2 [Amborella trichopoda] Length = 392 Score = 56.6 bits (135), Expect = 6e-06 Identities = 33/45 (73%), Positives = 34/45 (75%) Frame = -3 Query: 336 VNILVNSNGQIIRSDVVGALKMRTYLR*CWVWTERKSRDLVISYI 202 VNILVNSNGQIIRSDVVGALKMRTYLR V R D IS+I Sbjct: 181 VNILVNSNGQIIRSDVVGALKMRTYLR--CVRLARFENDRTISFI 223