BLASTX nr result
ID: Forsythia22_contig00042541
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00042541 (601 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003616777.1| hypothetical protein MTR_5g084150 [Medicago ... 60 8e-07 ref|XP_003605618.1| Photosystem II reaction center protein M [Me... 39 6e-06 >ref|XP_003616777.1| hypothetical protein MTR_5g084150 [Medicago truncatula] gi|355518112|gb|AES99735.1| hypothetical protein MTR_5g084150 [Medicago truncatula] Length = 187 Score = 60.1 bits (144), Expect = 8e-07 Identities = 36/80 (45%), Positives = 40/80 (50%) Frame = +3 Query: 129 GGSTRLANYWAELDLNQHKHIANKFTFCPC*LLRYQPRKNPF*AYW*SMTNFLS*YPTPR 308 GGS N+WAELDLNQ +HIAN+FT YPTPR Sbjct: 16 GGSV---NFWAELDLNQRRHIANEFT-----------------------------YPTPR 43 Query: 309 GIRIPAASLKERCSKQDNGG 368 G RIP ASLKERC K + G Sbjct: 44 GSRIPVASLKERCPKPLDDG 63 >ref|XP_003605618.1| Photosystem II reaction center protein M [Medicago truncatula] Length = 164 Score = 38.5 bits (88), Expect(2) = 6e-06 Identities = 22/38 (57%), Positives = 26/38 (68%), Gaps = 1/38 (2%) Frame = -1 Query: 412 IVHTMIIVRGLWASRPPLSC-LEHLSFKEAAGIRIPLG 302 +VH + + G AS PP S L HLSFKEA GIR+PLG Sbjct: 34 LVH-LFVTNGGRASMPPSSSGLGHLSFKEATGIRLPLG 70 Score = 38.5 bits (88), Expect(2) = 6e-06 Identities = 19/34 (55%), Positives = 24/34 (70%), Gaps = 4/34 (11%) Frame = -3 Query: 224 QLTGTECKFVGNMFMLVQIQLGPII----CQSGA 135 +L GT+CKFVGNM LVQIQL ++ CQ G+ Sbjct: 71 RLMGTDCKFVGNMSTLVQIQLVQLVRAPPCQGGS 104