BLASTX nr result
ID: Forsythia22_contig00040744
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00040744 (548 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007152671.1| hypothetical protein PHAVU_004G149400g [Phas... 95 2e-17 ref|XP_002321517.1| vacuolar protein sorting-associated protein ... 94 4e-17 ref|XP_006374197.1| hypothetical protein POPTR_0015s04670g [Popu... 94 4e-17 ref|XP_008465075.1| PREDICTED: Down syndrome critical region pro... 94 5e-17 ref|XP_008465011.1| PREDICTED: Down syndrome critical region pro... 94 5e-17 ref|XP_008464938.1| PREDICTED: Down syndrome critical region pro... 94 5e-17 ref|XP_002278791.1| PREDICTED: Down syndrome critical region pro... 93 6e-17 emb|CBI15584.3| unnamed protein product [Vitis vinifera] 93 6e-17 ref|XP_011650856.1| PREDICTED: Down syndrome critical region pro... 93 8e-17 ref|XP_011650848.1| PREDICTED: Down syndrome critical region pro... 93 8e-17 gb|KHN43630.1| Down syndrome critical region protein 3 like [Gly... 93 8e-17 ref|XP_006587470.1| PREDICTED: Down syndrome critical region pro... 93 8e-17 ref|XP_007152682.1| hypothetical protein PHAVU_004G150300g [Phas... 93 8e-17 ref|XP_004137506.1| PREDICTED: Down syndrome critical region pro... 93 8e-17 ref|XP_003534139.1| PREDICTED: Down syndrome critical region pro... 93 8e-17 ref|XP_002530476.1| down syndrome critical region protein, putat... 92 1e-16 ref|XP_008240142.1| PREDICTED: Down syndrome critical region pro... 92 2e-16 ref|XP_007209486.1| hypothetical protein PRUPE_ppa010156mg [Prun... 92 2e-16 ref|XP_012086278.1| PREDICTED: Down syndrome critical region pro... 91 2e-16 emb|CDO98339.1| unnamed protein product [Coffea canephora] 91 2e-16 >ref|XP_007152671.1| hypothetical protein PHAVU_004G149400g [Phaseolus vulgaris] gi|561025980|gb|ESW24665.1| hypothetical protein PHAVU_004G149400g [Phaseolus vulgaris] Length = 316 Score = 94.7 bits (234), Expect = 2e-17 Identities = 44/54 (81%), Positives = 49/54 (90%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CPTI AGPFS+EFKV+IVI+FQSELSK H DPKTPRLWLAME++PLELVRTK Sbjct: 263 CPTILAGPFSIEFKVAIVISFQSELSKLHKKSDPKTPRLWLAMETLPLELVRTK 316 >ref|XP_002321517.1| vacuolar protein sorting-associated protein 26 [Populus trichocarpa] gi|222868513|gb|EEF05644.1| vacuolar protein sorting-associated protein 26 [Populus trichocarpa] Length = 319 Score = 94.0 bits (232), Expect = 4e-17 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CP++FAGPFS+EFKVSIVI+FQSELSK H DP+TPRLWLAME++PLELVRT+ Sbjct: 266 CPSVFAGPFSIEFKVSIVISFQSELSKLHKKSDPRTPRLWLAMETLPLELVRTR 319 >ref|XP_006374197.1| hypothetical protein POPTR_0015s04670g [Populus trichocarpa] gi|550321939|gb|ERP51994.1| hypothetical protein POPTR_0015s04670g [Populus trichocarpa] Length = 320 Score = 94.0 bits (232), Expect = 4e-17 Identities = 42/54 (77%), Positives = 50/54 (92%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CP++FAGPFS+EFKVSIVI+FQSELSK H DP+TPRLWLAME++PLELVRT+ Sbjct: 267 CPSVFAGPFSIEFKVSIVISFQSELSKLHKKSDPRTPRLWLAMETLPLELVRTR 320 >ref|XP_008465075.1| PREDICTED: Down syndrome critical region protein 3 homolog isoform X3 [Cucumis melo] Length = 282 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK*DD 376 CPT+FAGPFS+EFKV IVITFQSELSK H DP+TPRLWLA+ES+P+EL+R + DD Sbjct: 226 CPTVFAGPFSIEFKVYIVITFQSELSKLHPKTDPRTPRLWLAIESLPMELIRCRSDD 282 >ref|XP_008465011.1| PREDICTED: Down syndrome critical region protein 3 homolog isoform X2 [Cucumis melo] Length = 285 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK*DD 376 CPT+FAGPFS+EFKV IVITFQSELSK H DP+TPRLWLA+ES+P+EL+R + DD Sbjct: 229 CPTVFAGPFSIEFKVYIVITFQSELSKLHPKTDPRTPRLWLAIESLPMELIRCRSDD 285 >ref|XP_008464938.1| PREDICTED: Down syndrome critical region protein 3 homolog isoform X1 [Cucumis melo] Length = 320 Score = 93.6 bits (231), Expect = 5e-17 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK*DD 376 CPT+FAGPFS+EFKV IVITFQSELSK H DP+TPRLWLA+ES+P+EL+R + DD Sbjct: 264 CPTVFAGPFSIEFKVYIVITFQSELSKLHPKTDPRTPRLWLAIESLPMELIRCRSDD 320 >ref|XP_002278791.1| PREDICTED: Down syndrome critical region protein 3 [Vitis vinifera] Length = 314 Score = 93.2 bits (230), Expect = 6e-17 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CPT+ AGPFS+EFK+SIVITF+SEL K H DPKTPRLWLAME++PLEL+RTK Sbjct: 261 CPTVLAGPFSIEFKISIVITFESELVKLHPKSDPKTPRLWLAMETIPLELIRTK 314 >emb|CBI15584.3| unnamed protein product [Vitis vinifera] Length = 314 Score = 93.2 bits (230), Expect = 6e-17 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CPT+ AGPFS+EFK+SIVITF+SEL K H DPKTPRLWLAME++PLEL+RTK Sbjct: 261 CPTVLAGPFSIEFKISIVITFESELVKLHPKSDPKTPRLWLAMETIPLELIRTK 314 >ref|XP_011650856.1| PREDICTED: Down syndrome critical region protein 3 homolog isoform X3 [Cucumis sativus] Length = 282 Score = 92.8 bits (229), Expect = 8e-17 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK*DD 376 CPT+FAGPFS+EFKV IVITFQSELSK H DP+TPRLWLA+ES+P+EL+R + DD Sbjct: 226 CPTVFAGPFSIEFKVYIVITFQSELSKLHPKTDPRTPRLWLAIESLPMELLRCRSDD 282 >ref|XP_011650848.1| PREDICTED: Down syndrome critical region protein 3 homolog isoform X2 [Cucumis sativus] Length = 285 Score = 92.8 bits (229), Expect = 8e-17 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK*DD 376 CPT+FAGPFS+EFKV IVITFQSELSK H DP+TPRLWLA+ES+P+EL+R + DD Sbjct: 229 CPTVFAGPFSIEFKVYIVITFQSELSKLHPKTDPRTPRLWLAIESLPMELLRCRSDD 285 >gb|KHN43630.1| Down syndrome critical region protein 3 like [Glycine soja] Length = 322 Score = 92.8 bits (229), Expect = 8e-17 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CPT AGPFSVEFKV+IVI+FQSELSK H DPKTPRLWLAME++PLEL+RTK Sbjct: 269 CPTTLAGPFSVEFKVAIVISFQSELSKLHKKSDPKTPRLWLAMETLPLELIRTK 322 >ref|XP_006587470.1| PREDICTED: Down syndrome critical region protein 3 homolog isoform X2 [Glycine max] Length = 310 Score = 92.8 bits (229), Expect = 8e-17 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CPT AGPFSVEFKV+IVI+FQSELSK H DPKTPRLWLAME++PLEL+RTK Sbjct: 257 CPTTLAGPFSVEFKVAIVISFQSELSKLHKKSDPKTPRLWLAMETLPLELIRTK 310 >ref|XP_007152682.1| hypothetical protein PHAVU_004G150300g [Phaseolus vulgaris] gi|561025991|gb|ESW24676.1| hypothetical protein PHAVU_004G150300g [Phaseolus vulgaris] Length = 316 Score = 92.8 bits (229), Expect = 8e-17 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CPTI AGPFS+EFKV+IVI+FQSELSK H DPKTPRLWLAME++PLELVR K Sbjct: 263 CPTILAGPFSIEFKVAIVISFQSELSKLHKKSDPKTPRLWLAMETLPLELVRAK 316 >ref|XP_004137506.1| PREDICTED: Down syndrome critical region protein 3 homolog isoform X1 [Cucumis sativus] gi|700209083|gb|KGN64179.1| hypothetical protein Csa_1G042860 [Cucumis sativus] Length = 320 Score = 92.8 bits (229), Expect = 8e-17 Identities = 42/57 (73%), Positives = 50/57 (87%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK*DD 376 CPT+FAGPFS+EFKV IVITFQSELSK H DP+TPRLWLA+ES+P+EL+R + DD Sbjct: 264 CPTVFAGPFSIEFKVYIVITFQSELSKLHPKTDPRTPRLWLAIESLPMELLRCRSDD 320 >ref|XP_003534139.1| PREDICTED: Down syndrome critical region protein 3 homolog isoform X1 [Glycine max] Length = 316 Score = 92.8 bits (229), Expect = 8e-17 Identities = 43/54 (79%), Positives = 48/54 (88%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CPT AGPFSVEFKV+IVI+FQSELSK H DPKTPRLWLAME++PLEL+RTK Sbjct: 263 CPTTLAGPFSVEFKVAIVISFQSELSKLHKKSDPKTPRLWLAMETLPLELIRTK 316 >ref|XP_002530476.1| down syndrome critical region protein, putative [Ricinus communis] gi|223529973|gb|EEF31899.1| down syndrome critical region protein, putative [Ricinus communis] Length = 272 Score = 92.0 bits (227), Expect = 1e-16 Identities = 41/54 (75%), Positives = 50/54 (92%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CPT+ AGPFS+EFKVSIVI+FQSELS+ H+ DP+TPRLWLAME++PLELVR+K Sbjct: 219 CPTVLAGPFSIEFKVSIVISFQSELSRLHTKSDPRTPRLWLAMETLPLELVRSK 272 >ref|XP_008240142.1| PREDICTED: Down syndrome critical region protein 3 homolog [Prunus mume] Length = 317 Score = 91.7 bits (226), Expect = 2e-16 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CPT+ AGPFS+EFKV+IVITFQS+++K HS DP TPRLWLAMES+PLELVRT+ Sbjct: 264 CPTVLAGPFSIEFKVAIVITFQSDVAKVHSKSDPTTPRLWLAMESLPLELVRTR 317 >ref|XP_007209486.1| hypothetical protein PRUPE_ppa010156mg [Prunus persica] gi|462405221|gb|EMJ10685.1| hypothetical protein PRUPE_ppa010156mg [Prunus persica] Length = 261 Score = 91.7 bits (226), Expect = 2e-16 Identities = 41/54 (75%), Positives = 49/54 (90%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CPT+ AGPFS+EFKV+IVITFQS+++K HS DP TPRLWLAMES+PLELVRT+ Sbjct: 208 CPTVLAGPFSIEFKVAIVITFQSDVAKVHSKSDPTTPRLWLAMESLPLELVRTR 261 >ref|XP_012086278.1| PREDICTED: Down syndrome critical region protein 3 homolog isoform X3 [Jatropha curcas] Length = 318 Score = 91.3 bits (225), Expect = 2e-16 Identities = 41/54 (75%), Positives = 48/54 (88%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CPT+ AGPFS+EFKVSIVI+FQSELSK H DP+ PRLWLAME++PLELVRT+ Sbjct: 265 CPTVLAGPFSIEFKVSIVISFQSELSKLHKKSDPRNPRLWLAMETLPLELVRTR 318 >emb|CDO98339.1| unnamed protein product [Coffea canephora] Length = 324 Score = 91.3 bits (225), Expect = 2e-16 Identities = 42/54 (77%), Positives = 48/54 (88%) Frame = -3 Query: 546 CPTIFAGPFSVEFKVSIVITFQSELSKKHSTYDPKTPRLWLAMESVPLELVRTK 385 CPTIFAGPFS+EFK +IVITF+SE +KKH YDPKTPR ++AMESVPLELVR K Sbjct: 271 CPTIFAGPFSIEFKTTIVITFKSEQTKKHPKYDPKTPRSYMAMESVPLELVRKK 324