BLASTX nr result
ID: Forsythia22_contig00040633
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00040633 (320 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU28190.1| hypothetical protein MIMGU_mgv1a020697mg [Erythra... 75 2e-11 >gb|EYU28190.1| hypothetical protein MIMGU_mgv1a020697mg [Erythranthe guttata] Length = 239 Score = 74.7 bits (182), Expect = 2e-11 Identities = 37/68 (54%), Positives = 49/68 (72%), Gaps = 2/68 (2%) Frame = -1 Query: 203 ENIIN-TEQTDSLGSPIYLDYDHATTTNA-STSSIQESEVPREFLTNSPDFPQTHDSPPQ 30 + I+N T+QTDSLG+PIYL+ +H+ T N S S++QESE P+EFL SP+FP TH S P+ Sbjct: 53 QGIVNSTQQTDSLGTPIYLNCNHSCTANTTSCSNLQESEAPQEFLPKSPNFPPTHHSSPR 112 Query: 29 ENHGGIQE 6 EN E Sbjct: 113 ENQAQFHE 120