BLASTX nr result
ID: Forsythia22_contig00039098
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00039098 (228 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15489.1| unnamed protein product [Coffea canephora] 60 6e-07 ref|XP_012831556.1| PREDICTED: pentatricopeptide repeat-containi... 59 2e-06 gb|EYU42174.1| hypothetical protein MIMGU_mgv1a0181001mg, partia... 59 2e-06 >emb|CDP15489.1| unnamed protein product [Coffea canephora] Length = 1003 Score = 60.1 bits (144), Expect = 6e-07 Identities = 29/38 (76%), Positives = 30/38 (78%) Frame = +3 Query: 3 DKGFIPSETTIYSLSSVLAKPGKEVDAQRMLEKLYKRK 116 DKGF PSETTI +S LAKPGK VDAQR LEK YKRK Sbjct: 964 DKGFTPSETTISCISPALAKPGKRVDAQRWLEKFYKRK 1001 >ref|XP_012831556.1| PREDICTED: pentatricopeptide repeat-containing protein At5g14770, mitochondrial [Erythranthe guttatus] Length = 959 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +3 Query: 3 DKGFIPSETTIYSLSSVLAKPGKEVDAQRMLEKLYKRKR 119 DKGF PSE +I LSSVLAKPGK DAQR+++K+YK KR Sbjct: 920 DKGFTPSENSINQLSSVLAKPGKAADAQRIMDKIYKTKR 958 >gb|EYU42174.1| hypothetical protein MIMGU_mgv1a0181001mg, partial [Erythranthe guttata] Length = 725 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = +3 Query: 3 DKGFIPSETTIYSLSSVLAKPGKEVDAQRMLEKLYKRKR 119 DKGF PSE +I LSSVLAKPGK DAQR+++K+YK KR Sbjct: 686 DKGFTPSENSINQLSSVLAKPGKAADAQRIMDKIYKTKR 724