BLASTX nr result
ID: Forsythia22_contig00038971
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00038971 (313 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70290.1| hypothetical protein VITISV_019345 [Vitis vinifera] 41 3e-07 >emb|CAN70290.1| hypothetical protein VITISV_019345 [Vitis vinifera] Length = 1464 Score = 41.2 bits (95), Expect(2) = 3e-07 Identities = 19/51 (37%), Positives = 26/51 (50%), Gaps = 22/51 (43%) Frame = -3 Query: 221 YYKDESICEVVEMDMCHVL----------------------WWYHKKIVLM 135 YYKDE +C+V++MD C++L WW+ KKIVLM Sbjct: 817 YYKDEIVCDVLDMDACYILLGRSWHYDVDVTYKGQDNTFVFWWFDKKIVLM 867 Score = 39.7 bits (91), Expect(2) = 3e-07 Identities = 18/23 (78%), Positives = 20/23 (86%) Frame = -2 Query: 312 KTLVKALNLKTEKHPSSCKSAWI 244 K LVKALNLKT++HPSS K AWI Sbjct: 774 KALVKALNLKTKEHPSSYKIAWI 796