BLASTX nr result
ID: Forsythia22_contig00038459
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00038459 (532 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089009.1| PREDICTED: putative pentatricopeptide repeat... 57 5e-06 >ref|XP_011089009.1| PREDICTED: putative pentatricopeptide repeat-containing protein At1g02420 [Sesamum indicum] Length = 511 Score = 57.0 bits (136), Expect = 5e-06 Identities = 27/35 (77%), Positives = 32/35 (91%) Frame = -2 Query: 531 SLQNLFEKMSAFGSSIQLSRNEVDELERPISDFIS 427 +L NL EKMSAFGS+IQ+++N VDELERPISDFIS Sbjct: 476 ALTNLSEKMSAFGSAIQMNKNNVDELERPISDFIS 510