BLASTX nr result
ID: Forsythia22_contig00038348
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00038348 (281 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010675629.1| PREDICTED: lanC-like protein GCR2 [Beta vulg... 66 8e-09 ref|XP_010245303.1| PREDICTED: lanC-like protein GCL2 [Nelumbo n... 64 5e-08 ref|XP_007021343.1| G protein coupled receptor [Theobroma cacao]... 64 5e-08 ref|XP_011098332.1| PREDICTED: lanC-like protein GCR2 [Sesamum i... 63 7e-08 ref|XP_010241999.1| PREDICTED: lanC-like protein GCL2 isoform X3... 63 7e-08 ref|XP_010241998.1| PREDICTED: lanC-like protein GCL2 isoform X2... 63 7e-08 ref|XP_010241996.1| PREDICTED: lanC-like protein GCL2 isoform X1... 63 7e-08 ref|XP_009767466.1| PREDICTED: lanC-like protein GCL2 isoform X2... 63 7e-08 ref|XP_009767465.1| PREDICTED: lanC-like protein GCL2 isoform X1... 63 7e-08 ref|XP_009617549.1| PREDICTED: lanC-like protein GCL2 isoform X2... 63 7e-08 ref|XP_009617548.1| PREDICTED: lanC-like protein GCL2 isoform X1... 63 7e-08 ref|XP_012088306.1| PREDICTED: lanC-like protein GCL2 [Jatropha ... 63 7e-08 ref|XP_010099009.1| hypothetical protein L484_025669 [Morus nota... 62 1e-07 ref|XP_010686440.1| PREDICTED: lanC-like protein GCL2 [Beta vulg... 62 1e-07 ref|XP_012464739.1| PREDICTED: lanC-like protein GCL2 [Gossypium... 62 2e-07 gb|KHG20582.1| LanC-like protein 2 [Gossypium arboreum] 62 2e-07 ref|XP_012084921.1| PREDICTED: lanC-like protein GCR2 [Jatropha ... 62 2e-07 emb|CDP14758.1| unnamed protein product [Coffea canephora] 61 3e-07 ref|XP_002534246.1| catalytic, putative [Ricinus communis] gi|22... 61 3e-07 ref|XP_012575353.1| PREDICTED: lanC-like protein GCL2 isoform X2... 60 4e-07 >ref|XP_010675629.1| PREDICTED: lanC-like protein GCR2 [Beta vulgaris subsp. vulgaris] gi|870861780|gb|KMT13050.1| hypothetical protein BVRB_4g087620 [Beta vulgaris subsp. vulgaris] Length = 408 Score = 66.2 bits (160), Expect = 8e-09 Identities = 29/33 (87%), Positives = 31/33 (93%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEG+GGMAYLFLDMNEP E+RFPAYEL Sbjct: 376 DRPYSLFEGLGGMAYLFLDMNEPAEARFPAYEL 408 >ref|XP_010245303.1| PREDICTED: lanC-like protein GCL2 [Nelumbo nucifera] Length = 420 Score = 63.5 bits (153), Expect = 5e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP E+RFPAYEL Sbjct: 388 DRPYSLFEGIGGMAYLFLDMIEPAEARFPAYEL 420 >ref|XP_007021343.1| G protein coupled receptor [Theobroma cacao] gi|508720971|gb|EOY12868.1| G protein coupled receptor [Theobroma cacao] Length = 406 Score = 63.5 bits (153), Expect = 5e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP E+RFPAYE+ Sbjct: 374 DRPYSLFEGIGGMAYLFLDMGEPSEARFPAYEI 406 >ref|XP_011098332.1| PREDICTED: lanC-like protein GCR2 [Sesamum indicum] Length = 403 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP ++RFPAYEL Sbjct: 371 DRPYSLFEGIGGMAYLFLDMTEPSQARFPAYEL 403 >ref|XP_010241999.1| PREDICTED: lanC-like protein GCL2 isoform X3 [Nelumbo nucifera] Length = 408 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP E+RFPAYEL Sbjct: 376 DSPYSLFEGIGGMAYLFLDMIEPSEARFPAYEL 408 >ref|XP_010241998.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nelumbo nucifera] Length = 409 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP E+RFPAYEL Sbjct: 377 DSPYSLFEGIGGMAYLFLDMIEPSEARFPAYEL 409 >ref|XP_010241996.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nelumbo nucifera] Length = 436 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP E+RFPAYEL Sbjct: 404 DSPYSLFEGIGGMAYLFLDMIEPSEARFPAYEL 436 >ref|XP_009767466.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nicotiana sylvestris] Length = 408 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP E+RFPAYEL Sbjct: 376 DRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL 408 >ref|XP_009767465.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nicotiana sylvestris] Length = 410 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP E+RFPAYEL Sbjct: 378 DRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL 410 >ref|XP_009617549.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Nicotiana tomentosiformis] Length = 408 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP E+RFPAYEL Sbjct: 376 DRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL 408 >ref|XP_009617548.1| PREDICTED: lanC-like protein GCL2 isoform X1 [Nicotiana tomentosiformis] Length = 410 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/33 (87%), Positives = 30/33 (90%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP E+RFPAYEL Sbjct: 378 DRPYSLFEGIGGMAYLFLDMIEPMETRFPAYEL 410 >ref|XP_012088306.1| PREDICTED: lanC-like protein GCL2 [Jatropha curcas] gi|643709741|gb|KDP24150.1| hypothetical protein JCGZ_25807 [Jatropha curcas] Length = 414 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLD EP ESRFPAYEL Sbjct: 382 DSPYSLFEGIGGMAYLFLDTTEPSESRFPAYEL 414 >ref|XP_010099009.1| hypothetical protein L484_025669 [Morus notabilis] gi|587887571|gb|EXB76311.1| hypothetical protein L484_025669 [Morus notabilis] Length = 409 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/33 (84%), Positives = 30/33 (90%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMA+LFLDM EP E+RFPAYEL Sbjct: 377 DHPYSLFEGIGGMAHLFLDMTEPSEARFPAYEL 409 >ref|XP_010686440.1| PREDICTED: lanC-like protein GCL2 [Beta vulgaris subsp. vulgaris] gi|870852723|gb|KMT04638.1| hypothetical protein BVRB_8g182910 [Beta vulgaris subsp. vulgaris] Length = 410 Score = 62.0 bits (149), Expect = 1e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP +RFPAYEL Sbjct: 378 DNPYSLFEGIGGMAYLFLDMKEPTSARFPAYEL 410 >ref|XP_012464739.1| PREDICTED: lanC-like protein GCL2 [Gossypium raimondii] gi|763813116|gb|KJB79968.1| hypothetical protein B456_013G075200 [Gossypium raimondii] Length = 409 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP SRFPAYEL Sbjct: 377 DRPYSLFEGIGGMAYLFLDMIEPLGSRFPAYEL 409 >gb|KHG20582.1| LanC-like protein 2 [Gossypium arboreum] Length = 409 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/33 (87%), Positives = 29/33 (87%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP SRFPAYEL Sbjct: 377 DRPYSLFEGIGGMAYLFLDMIEPLGSRFPAYEL 409 >ref|XP_012084921.1| PREDICTED: lanC-like protein GCR2 [Jatropha curcas] gi|643714523|gb|KDP27026.1| hypothetical protein JCGZ_20961 [Jatropha curcas] Length = 408 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLF DM EP E+RFPAYEL Sbjct: 376 DRPYSLFEGIGGMAYLFFDMIEPSEARFPAYEL 408 >emb|CDP14758.1| unnamed protein product [Coffea canephora] Length = 421 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/33 (84%), Positives = 29/33 (87%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEGIGGMAYLFLDM EP +RFPAYEL Sbjct: 389 DSPYSLFEGIGGMAYLFLDMVEPTNARFPAYEL 421 >ref|XP_002534246.1| catalytic, putative [Ricinus communis] gi|223525647|gb|EEF28136.1| catalytic, putative [Ricinus communis] Length = 419 Score = 61.2 bits (147), Expect = 3e-07 Identities = 27/33 (81%), Positives = 29/33 (87%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEG+GGMAYLF DM EP E+RFPAYEL Sbjct: 387 DRPYSLFEGVGGMAYLFFDMIEPSEARFPAYEL 419 >ref|XP_012575353.1| PREDICTED: lanC-like protein GCL2 isoform X2 [Cicer arietinum] Length = 352 Score = 60.5 bits (145), Expect = 4e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 280 DLPYSLFEGIGGMAYLFLDMNEPCESRFPAYEL 182 D PYSLFEG+GGMAYLFLDM +P +S+FPAYEL Sbjct: 320 DRPYSLFEGVGGMAYLFLDMVDPSQSKFPAYEL 352