BLASTX nr result
ID: Forsythia22_contig00037624
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00037624 (427 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011086554.1| PREDICTED: ubiquitin-like-specific protease ... 60 4e-07 ref|XP_009762756.1| PREDICTED: ubiquitin-like-specific protease ... 60 6e-07 ref|XP_009600333.1| PREDICTED: ubiquitin-like-specific protease ... 60 6e-07 ref|XP_006341855.1| PREDICTED: ubiquitin-like-specific protease ... 60 6e-07 ref|XP_006341853.1| PREDICTED: ubiquitin-like-specific protease ... 60 6e-07 ref|XP_009618504.1| PREDICTED: ubiquitin-like-specific protease ... 59 1e-06 ref|XP_006365213.1| PREDICTED: ubiquitin-like-specific protease ... 59 1e-06 ref|XP_006365211.1| PREDICTED: ubiquitin-like-specific protease ... 59 1e-06 ref|XP_006365210.1| PREDICTED: ubiquitin-like-specific protease ... 59 1e-06 ref|XP_010320591.1| PREDICTED: ubiquitin-like-specific protease ... 59 1e-06 ref|XP_010320589.1| PREDICTED: ubiquitin-like-specific protease ... 59 1e-06 ref|XP_010320588.1| PREDICTED: ubiquitin-like-specific protease ... 59 1e-06 ref|XP_006341854.1| PREDICTED: ubiquitin-like-specific protease ... 59 1e-06 ref|XP_010319598.1| PREDICTED: ubiquitin-like-specific protease ... 59 2e-06 ref|XP_010319597.1| PREDICTED: ubiquitin-like-specific protease ... 59 2e-06 ref|XP_009762757.1| PREDICTED: ubiquitin-like-specific protease ... 59 2e-06 ref|XP_009600338.1| PREDICTED: ubiquitin-like-specific protease ... 59 2e-06 ref|XP_004237267.1| PREDICTED: ubiquitin-like-specific protease ... 59 2e-06 ref|XP_010653416.1| PREDICTED: ubiquitin-like-specific protease ... 58 2e-06 ref|XP_010653412.1| PREDICTED: ubiquitin-like-specific protease ... 58 2e-06 >ref|XP_011086554.1| PREDICTED: ubiquitin-like-specific protease 1D [Sesamum indicum] Length = 501 Score = 60.5 bits (145), Expect = 4e-07 Identities = 25/29 (86%), Positives = 28/29 (96%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 + ++ETSFVKFRRWWKGVNIFEKAYIFLP Sbjct: 318 KTDKETSFVKFRRWWKGVNIFEKAYIFLP 346 >ref|XP_009762756.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X1 [Nicotiana sylvestris] Length = 535 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 QN++E SFVK RRWWKGVNIFEKAYIFLP Sbjct: 357 QNDKEASFVKLRRWWKGVNIFEKAYIFLP 385 >ref|XP_009600333.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X1 [Nicotiana tomentosiformis] Length = 532 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 QN++E SFVK RRWWKGVNIFEKAYIFLP Sbjct: 354 QNDKEASFVKLRRWWKGVNIFEKAYIFLP 382 >ref|XP_006341855.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X3 [Solanum tuberosum] Length = 419 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 QNE+E SFV+ RRWWKGVNIFEKAYIFLP Sbjct: 240 QNEKEASFVRLRRWWKGVNIFEKAYIFLP 268 >ref|XP_006341853.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X1 [Solanum tuberosum] Length = 443 Score = 60.1 bits (144), Expect = 6e-07 Identities = 25/29 (86%), Positives = 27/29 (93%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 QNE+E SFV+ RRWWKGVNIFEKAYIFLP Sbjct: 264 QNEKEASFVRLRRWWKGVNIFEKAYIFLP 292 >ref|XP_009618504.1| PREDICTED: ubiquitin-like-specific protease 1D [Nicotiana tomentosiformis] Length = 470 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 QNE+E SF K RRWWKGVNIFEKAYIFLP Sbjct: 292 QNEKEASFFKLRRWWKGVNIFEKAYIFLP 320 >ref|XP_006365213.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X4 [Solanum tuberosum] Length = 527 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 QNE+E SF K RRWWKGVNIFEKAYIFLP Sbjct: 349 QNEKEASFFKLRRWWKGVNIFEKAYIFLP 377 >ref|XP_006365211.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X2 [Solanum tuberosum] Length = 528 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 QNE+E SF K RRWWKGVNIFEKAYIFLP Sbjct: 350 QNEKEASFFKLRRWWKGVNIFEKAYIFLP 378 >ref|XP_006365210.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X1 [Solanum tuberosum] Length = 529 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 QNE+E SF K RRWWKGVNIFEKAYIFLP Sbjct: 351 QNEKEASFFKLRRWWKGVNIFEKAYIFLP 379 >ref|XP_010320591.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X4 [Solanum lycopersicum] Length = 527 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 QNE+E FVK RRWWKGVNIFEKAYIFLP Sbjct: 349 QNEKEALFVKLRRWWKGVNIFEKAYIFLP 377 >ref|XP_010320589.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X2 [Solanum lycopersicum] Length = 528 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 QNE+E FVK RRWWKGVNIFEKAYIFLP Sbjct: 350 QNEKEALFVKLRRWWKGVNIFEKAYIFLP 378 >ref|XP_010320588.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X1 [Solanum lycopersicum] Length = 529 Score = 58.9 bits (141), Expect = 1e-06 Identities = 25/29 (86%), Positives = 26/29 (89%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 QNE+E FVK RRWWKGVNIFEKAYIFLP Sbjct: 351 QNEKEALFVKLRRWWKGVNIFEKAYIFLP 379 >ref|XP_006341854.1| PREDICTED: ubiquitin-like-specific protease 1D-like isoform X2 [Solanum tuberosum] Length = 442 Score = 58.9 bits (141), Expect = 1e-06 Identities = 24/31 (77%), Positives = 28/31 (90%) Frame = -3 Query: 95 IMQNERETSFVKFRRWWKGVNIFEKAYIFLP 3 + +NE+E SFV+ RRWWKGVNIFEKAYIFLP Sbjct: 261 LSKNEKEASFVRLRRWWKGVNIFEKAYIFLP 291 >ref|XP_010319598.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X3 [Solanum lycopersicum] Length = 401 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 95 IMQNERETSFVKFRRWWKGVNIFEKAYIFLP 3 + +NE+E SF++ RRWWKGVNIFEKAYIFLP Sbjct: 261 LSKNEKEASFIRLRRWWKGVNIFEKAYIFLP 291 >ref|XP_010319597.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X2 [Solanum lycopersicum] Length = 437 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 95 IMQNERETSFVKFRRWWKGVNIFEKAYIFLP 3 + +NE+E SF++ RRWWKGVNIFEKAYIFLP Sbjct: 256 LSKNEKEASFIRLRRWWKGVNIFEKAYIFLP 286 >ref|XP_009762757.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X2 [Nicotiana sylvestris] Length = 534 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 +N++E SFVK RRWWKGVNIFEKAYIFLP Sbjct: 356 KNDKEASFVKLRRWWKGVNIFEKAYIFLP 384 >ref|XP_009600338.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X2 [Nicotiana tomentosiformis] Length = 531 Score = 58.5 bits (140), Expect = 2e-06 Identities = 24/29 (82%), Positives = 27/29 (93%) Frame = -3 Query: 89 QNERETSFVKFRRWWKGVNIFEKAYIFLP 3 +N++E SFVK RRWWKGVNIFEKAYIFLP Sbjct: 353 KNDKEASFVKLRRWWKGVNIFEKAYIFLP 381 >ref|XP_004237267.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X1 [Solanum lycopersicum] gi|723691458|ref|XP_010319596.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X1 [Solanum lycopersicum] Length = 442 Score = 58.5 bits (140), Expect = 2e-06 Identities = 23/31 (74%), Positives = 28/31 (90%) Frame = -3 Query: 95 IMQNERETSFVKFRRWWKGVNIFEKAYIFLP 3 + +NE+E SF++ RRWWKGVNIFEKAYIFLP Sbjct: 261 LSKNEKEASFIRLRRWWKGVNIFEKAYIFLP 291 >ref|XP_010653416.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X4 [Vitis vinifera] Length = 454 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 101 LSIMQNERETSFVKFRRWWKGVNIFEKAYIFLP 3 LS +++ETSF+KFRRWWKGVNIF+KAYI LP Sbjct: 373 LSYKGSDKETSFIKFRRWWKGVNIFQKAYILLP 405 >ref|XP_010653412.1| PREDICTED: ubiquitin-like-specific protease 1D isoform X3 [Vitis vinifera] Length = 469 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/33 (72%), Positives = 29/33 (87%) Frame = -3 Query: 101 LSIMQNERETSFVKFRRWWKGVNIFEKAYIFLP 3 LS +++ETSF+KFRRWWKGVNIF+KAYI LP Sbjct: 373 LSYKGSDKETSFIKFRRWWKGVNIFQKAYILLP 405