BLASTX nr result
ID: Forsythia22_contig00037531
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00037531 (213 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB36828.1| putative protein [Arabidopsis thaliana] gi|72680... 56 8e-06 >emb|CAB36828.1| putative protein [Arabidopsis thaliana] gi|7268068|emb|CAB78406.1| putative protein [Arabidopsis thaliana] Length = 302 Score = 56.2 bits (134), Expect = 8e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -3 Query: 211 ATPKAIMRTMGVKGLTLFHLKSHLQVLFLI 122 ATPK IMRTMGVKGLTL+HLKSHLQVL L+ Sbjct: 71 ATPKTIMRTMGVKGLTLYHLKSHLQVLMLL 100