BLASTX nr result
ID: Forsythia22_contig00037177
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00037177 (593 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP15082.1| unnamed protein product [Coffea canephora] 78 3e-12 ref|XP_002278192.2| PREDICTED: BTB/POZ and TAZ domain-containing... 76 1e-11 emb|CBI14900.3| unnamed protein product [Vitis vinifera] 76 1e-11 ref|XP_007037820.1| BTB and TAZ domain protein 2 isoform 3, part... 71 3e-10 ref|XP_007037819.1| BTB and TAZ domain protein 2 isoform 2 [Theo... 71 3e-10 ref|XP_007037818.1| BTB and TAZ domain protein 2 isoform 1 [Theo... 71 3e-10 ref|XP_007209189.1| hypothetical protein PRUPE_ppa006416mg [Prun... 71 3e-10 ref|XP_011086988.1| PREDICTED: BTB/POZ and TAZ domain-containing... 70 7e-10 ref|XP_009359517.1| PREDICTED: BTB/POZ and TAZ domain-containing... 70 1e-09 ref|XP_010250936.1| PREDICTED: BTB/POZ and TAZ domain-containing... 69 1e-09 ref|XP_010250935.1| PREDICTED: BTB/POZ and TAZ domain-containing... 69 1e-09 ref|XP_008374350.1| PREDICTED: BTB/POZ and TAZ domain-containing... 69 1e-09 ref|XP_009631180.1| PREDICTED: BTB/POZ and TAZ domain-containing... 63 2e-09 ref|XP_009333905.1| PREDICTED: BTB/POZ and TAZ domain-containing... 67 5e-09 ref|XP_008239370.1| PREDICTED: BTB/POZ and TAZ domain-containing... 67 5e-09 ref|XP_006476936.1| PREDICTED: BTB/POZ and TAZ domain-containing... 67 6e-09 ref|XP_008360767.1| PREDICTED: BTB/POZ and TAZ domain-containing... 67 8e-09 ref|XP_009767731.1| PREDICTED: BTB/POZ and TAZ domain-containing... 66 1e-08 ref|XP_009780507.1| PREDICTED: BTB/POZ and TAZ domain-containing... 66 1e-08 ref|XP_002511276.1| protein binding protein, putative [Ricinus c... 66 1e-08 >emb|CDP15082.1| unnamed protein product [Coffea canephora] Length = 355 Score = 78.2 bits (191), Expect = 3e-12 Identities = 36/51 (70%), Positives = 43/51 (84%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEEPRTQKS 363 CRQFKLK QQ+++GEDARW+LLVRKV+SAK + L+LPK KREEEPR S Sbjct: 296 CRQFKLKAQQEKKGEDARWKLLVRKVISAKALSSLSLPKRKREEEPRLNLS 346 >ref|XP_002278192.2| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Vitis vinifera] Length = 403 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEEPR 375 CRQFKLK QQ ++GEDARW+LLVRKVVSAK + L+LPK KREEEPR Sbjct: 343 CRQFKLKAQQVKKGEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPR 389 >emb|CBI14900.3| unnamed protein product [Vitis vinifera] Length = 347 Score = 75.9 bits (185), Expect = 1e-11 Identities = 36/47 (76%), Positives = 41/47 (87%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEEPR 375 CRQFKLK QQ ++GEDARW+LLVRKVVSAK + L+LPK KREEEPR Sbjct: 287 CRQFKLKAQQVKKGEDARWKLLVRKVVSAKAMSSLSLPKRKREEEPR 333 >ref|XP_007037820.1| BTB and TAZ domain protein 2 isoform 3, partial [Theobroma cacao] gi|508775065|gb|EOY22321.1| BTB and TAZ domain protein 2 isoform 3, partial [Theobroma cacao] Length = 253 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEEPR 375 CRQFKLK QQ R G+DA W+LLVRKV+SAKTI L+LPK KREEE R Sbjct: 193 CRQFKLKAQQQRMGDDALWKLLVRKVLSAKTISSLSLPKRKREEELR 239 >ref|XP_007037819.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma cacao] gi|508775064|gb|EOY22320.1| BTB and TAZ domain protein 2 isoform 2 [Theobroma cacao] Length = 334 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEEPR 375 CRQFKLK QQ R G+DA W+LLVRKV+SAKTI L+LPK KREEE R Sbjct: 274 CRQFKLKAQQQRMGDDALWKLLVRKVLSAKTISSLSLPKRKREEELR 320 >ref|XP_007037818.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma cacao] gi|508775063|gb|EOY22319.1| BTB and TAZ domain protein 2 isoform 1 [Theobroma cacao] Length = 354 Score = 71.2 bits (173), Expect = 3e-10 Identities = 35/47 (74%), Positives = 39/47 (82%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEEPR 375 CRQFKLK QQ R G+DA W+LLVRKV+SAKTI L+LPK KREEE R Sbjct: 294 CRQFKLKAQQQRMGDDALWKLLVRKVLSAKTISSLSLPKRKREEELR 340 >ref|XP_007209189.1| hypothetical protein PRUPE_ppa006416mg [Prunus persica] gi|462404924|gb|EMJ10388.1| hypothetical protein PRUPE_ppa006416mg [Prunus persica] Length = 413 Score = 71.2 bits (173), Expect = 3e-10 Identities = 33/45 (73%), Positives = 41/45 (91%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEE 381 CRQFKLK+QQ+++ +DARW+LLVRKVVSA+TI L+LPK KREEE Sbjct: 354 CRQFKLKMQQEKKKDDARWKLLVRKVVSARTISSLSLPKRKREEE 398 >ref|XP_011086988.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Sesamum indicum] Length = 353 Score = 70.1 bits (170), Expect = 7e-10 Identities = 36/48 (75%), Positives = 38/48 (79%), Gaps = 1/48 (2%) Frame = -1 Query: 515 CRQFKLKVQQDRRG-EDARWRLLVRKVVSAKTIYCLTLPKWKREEEPR 375 CRQFKLK QQD RG D RWRLLVRKV SAK + L+LPK KREEEPR Sbjct: 292 CRQFKLKAQQDPRGGSDERWRLLVRKVASAKAMSSLSLPKRKREEEPR 339 >ref|XP_009359517.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Pyrus x bretschneideri] Length = 360 Score = 69.7 bits (169), Expect = 1e-09 Identities = 32/45 (71%), Positives = 41/45 (91%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEE 381 CRQFKLK+QQ+++ ++ARW+LLV+KVVSAKTI L+LPK KREEE Sbjct: 297 CRQFKLKMQQEKKRDEARWKLLVKKVVSAKTISSLSLPKRKREEE 341 >ref|XP_010250936.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X2 [Nelumbo nucifera] Length = 368 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEEPR 375 CRQFKL+ Q +++G+DARWRLLVR+V+SAK +Y L+L K KREE PR Sbjct: 306 CRQFKLRTQLEKKGDDARWRLLVRRVMSAKAMYSLSLSKRKREEGPR 352 >ref|XP_010250935.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like isoform X1 [Nelumbo nucifera] Length = 369 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/47 (65%), Positives = 40/47 (85%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEEPR 375 CRQFKL+ Q +++G+DARWRLLVR+V+SAK +Y L+L K KREE PR Sbjct: 307 CRQFKLRTQLEKKGDDARWRLLVRRVMSAKAMYSLSLSKRKREEGPR 353 >ref|XP_008374350.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Malus domestica] Length = 361 Score = 69.3 bits (168), Expect = 1e-09 Identities = 31/45 (68%), Positives = 41/45 (91%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEE 381 CRQFKLK+QQ+++ +DARW+LLV+KV+SAKT+ L+LPK KREEE Sbjct: 297 CRQFKLKMQQEKKTDDARWKLLVKKVMSAKTLSSLSLPKRKREEE 341 >ref|XP_009631180.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana tomentosiformis] Length = 345 Score = 63.2 bits (152), Expect(2) = 2e-09 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEEPR 375 CRQ K+KVQQ +G+DA W LVRKVVSA+TI L+LPK KREEEP+ Sbjct: 290 CRQLKVKVQQ--KGDDALWESLVRKVVSARTISSLSLPKRKREEEPK 334 Score = 25.4 bits (54), Expect(2) = 2e-09 Identities = 10/20 (50%), Positives = 15/20 (75%), Gaps = 3/20 (15%) Frame = -2 Query: 394 REKRNQEPK---NHHEIRSF 344 + KR +EPK +HH++RSF Sbjct: 326 KRKREEEPKMNLDHHQVRSF 345 >ref|XP_009333905.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Pyrus x bretschneideri] Length = 358 Score = 67.4 bits (163), Expect = 5e-09 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEE 381 CRQFKLK+ Q+++ +DARW+LLV+KV+SAKTI L+LPK KREEE Sbjct: 294 CRQFKLKMLQEKKTDDARWKLLVKKVMSAKTISSLSLPKRKREEE 338 >ref|XP_008239370.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Prunus mume] Length = 360 Score = 67.4 bits (163), Expect = 5e-09 Identities = 32/45 (71%), Positives = 39/45 (86%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEE 381 CRQFKLK+ +++ +DARW+LLVRKVVSAKTI L+LPK KREEE Sbjct: 301 CRQFKLKMLAEKKKDDARWKLLVRKVVSAKTISSLSLPKRKREEE 345 >ref|XP_006476936.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Citrus sinensis] Length = 363 Score = 67.0 bits (162), Expect = 6e-09 Identities = 32/47 (68%), Positives = 38/47 (80%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEEPR 375 CRQFKLK QQ+++G+D RWRLLV+KVVSAKTI L+ K KR EE R Sbjct: 304 CRQFKLKAQQEKKGDDGRWRLLVKKVVSAKTISSLSQQKRKRMEESR 350 >ref|XP_008360767.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Malus domestica] Length = 360 Score = 66.6 bits (161), Expect = 8e-09 Identities = 31/45 (68%), Positives = 40/45 (88%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEE 381 CRQFKLK+QQ+++ ++ARW+LLV+KVVSAKTI L+L K KREEE Sbjct: 297 CRQFKLKMQQEKKRDEARWKLLVKKVVSAKTISSLSLSKRKREEE 341 >ref|XP_009767731.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1-like [Nicotiana sylvestris] Length = 351 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEEPR 375 CRQFK+KVQQ +G+DA W LVRKVVSA+TI L+LPK KREEEP+ Sbjct: 290 CRQFKMKVQQ--KGDDALWESLVRKVVSARTISSLSLPKRKREEEPK 334 >ref|XP_009780507.1| PREDICTED: BTB/POZ and TAZ domain-containing protein 1 [Nicotiana sylvestris] Length = 351 Score = 65.9 bits (159), Expect = 1e-08 Identities = 33/47 (70%), Positives = 39/47 (82%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEEPR 375 CRQFK+KVQQ +G+DA W LVRKVVSA+TI L+LPK KREEEP+ Sbjct: 290 CRQFKMKVQQ--KGDDALWESLVRKVVSARTISSLSLPKRKREEEPK 334 >ref|XP_002511276.1| protein binding protein, putative [Ricinus communis] gi|223550391|gb|EEF51878.1| protein binding protein, putative [Ricinus communis] Length = 363 Score = 65.9 bits (159), Expect = 1e-08 Identities = 29/45 (64%), Positives = 39/45 (86%) Frame = -1 Query: 515 CRQFKLKVQQDRRGEDARWRLLVRKVVSAKTIYCLTLPKWKREEE 381 CRQFKLK+Q +++G+DA W+LLVRKVVSA+ + L+LPK KREE+ Sbjct: 304 CRQFKLKMQHEKKGDDALWKLLVRKVVSARVLSSLSLPKRKREEQ 348