BLASTX nr result
ID: Forsythia22_contig00036179
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00036179 (911 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012464801.1| PREDICTED: origin of replication complex sub... 63 2e-07 ref|XP_006396706.1| hypothetical protein EUTSA_v10028947mg [Eutr... 62 7e-07 ref|XP_012449983.1| PREDICTED: protein polybromo-1-like isoform ... 61 9e-07 ref|XP_012449976.1| PREDICTED: BAH and coiled-coil domain-contai... 61 9e-07 ref|XP_012480372.1| PREDICTED: origin of replication complex sub... 61 9e-07 gb|KJB12193.1| hypothetical protein B456_002G005000 [Gossypium r... 61 9e-07 gb|KJB12190.1| hypothetical protein B456_002G005000 [Gossypium r... 61 9e-07 ref|XP_012449979.1| PREDICTED: protein polybromo-1-like isoform ... 61 9e-07 gb|KJB12186.1| hypothetical protein B456_002G005000 [Gossypium r... 61 9e-07 ref|XP_011092827.1| PREDICTED: chromatin structure-remodeling co... 61 9e-07 ref|XP_011088452.1| PREDICTED: chromatin structure-remodeling co... 61 9e-07 ref|XP_010690826.1| PREDICTED: protein polybromo-1-like [Beta vu... 61 9e-07 gb|KHG24065.1| BAH and coiled-coil domain-containing 1 [Gossypiu... 61 9e-07 gb|KHG13285.1| BAH and coiled-coil domain-containing 1 [Gossypiu... 61 9e-07 ref|XP_009777046.1| PREDICTED: chromatin structure-remodeling co... 61 9e-07 ref|XP_009777045.1| PREDICTED: chromatin structure-remodeling co... 61 9e-07 ref|XP_009614463.1| PREDICTED: protein polybromo-1-like isoform ... 61 9e-07 ref|XP_009614462.1| PREDICTED: chromatin structure-remodeling co... 61 9e-07 ref|XP_009347851.1| PREDICTED: protein polybromo-1-like isoform ... 61 9e-07 ref|XP_009347850.1| PREDICTED: BAH and coiled-coil domain-contai... 61 9e-07 >ref|XP_012464801.1| PREDICTED: origin of replication complex subunit 1A-like isoform X3 [Gossypium raimondii] Length = 187 Score = 63.2 bits (152), Expect = 2e-07 Identities = 26/44 (59%), Positives = 30/44 (68%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW*VQRPRIVV*VDNFTWLHFGC 779 YCKCEMPYNPDDLMVQCE CSDW ++ N+ W +F C Sbjct: 141 YCKCEMPYNPDDLMVQCEDCSDWSLK---------NWNWYYFSC 175 >ref|XP_006396706.1| hypothetical protein EUTSA_v10028947mg [Eutrema salsugineum] gi|557097723|gb|ESQ38159.1| hypothetical protein EUTSA_v10028947mg [Eutrema salsugineum] Length = 225 Score = 61.6 bits (148), Expect = 7e-07 Identities = 30/47 (63%), Positives = 33/47 (70%), Gaps = 2/47 (4%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW*VQRPRIV-V*VDNFTWL-HFGCT 776 YCKCEMPYNPDDLMVQCEGC DW P V + ++ T L HF CT Sbjct: 149 YCKCEMPYNPDDLMVQCEGCKDW--YHPACVGMTIEEATKLEHFACT 193 >ref|XP_012449983.1| PREDICTED: protein polybromo-1-like isoform X3 [Gossypium raimondii] Length = 210 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >ref|XP_012449976.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like isoform X1 [Gossypium raimondii] Length = 240 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >ref|XP_012480372.1| PREDICTED: origin of replication complex subunit 1B [Gossypium raimondii] gi|763765283|gb|KJB32537.1| hypothetical protein B456_005G246700 [Gossypium raimondii] Length = 216 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >gb|KJB12193.1| hypothetical protein B456_002G005000 [Gossypium raimondii] Length = 163 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >gb|KJB12190.1| hypothetical protein B456_002G005000 [Gossypium raimondii] Length = 187 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 111 YCKCEMPYNPDDLMVQCEGCSDW 133 >ref|XP_012449979.1| PREDICTED: protein polybromo-1-like isoform X2 [Gossypium raimondii] gi|763744749|gb|KJB12188.1| hypothetical protein B456_002G005000 [Gossypium raimondii] Length = 217 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >gb|KJB12186.1| hypothetical protein B456_002G005000 [Gossypium raimondii] Length = 243 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >ref|XP_011092827.1| PREDICTED: chromatin structure-remodeling complex subunit RSC1-like [Sesamum indicum] Length = 216 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >ref|XP_011088452.1| PREDICTED: chromatin structure-remodeling complex subunit RSC2 isoform X1 [Sesamum indicum] gi|747082279|ref|XP_011088453.1| PREDICTED: chromatin structure-remodeling complex subunit RSC2 isoform X1 [Sesamum indicum] gi|747082281|ref|XP_011088454.1| PREDICTED: chromatin structure-remodeling complex subunit RSC2 isoform X1 [Sesamum indicum] Length = 216 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >ref|XP_010690826.1| PREDICTED: protein polybromo-1-like [Beta vulgaris subsp. vulgaris] gi|870848103|gb|KMT00392.1| hypothetical protein BVRB_9g216970 [Beta vulgaris subsp. vulgaris] Length = 225 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >gb|KHG24065.1| BAH and coiled-coil domain-containing 1 [Gossypium arboreum] Length = 216 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >gb|KHG13285.1| BAH and coiled-coil domain-containing 1 [Gossypium arboreum] Length = 217 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >ref|XP_009777046.1| PREDICTED: chromatin structure-remodeling complex subunit RSC1-like isoform X2 [Nicotiana sylvestris] Length = 211 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >ref|XP_009777045.1| PREDICTED: chromatin structure-remodeling complex subunit RSC1-like isoform X1 [Nicotiana sylvestris] Length = 216 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >ref|XP_009614463.1| PREDICTED: protein polybromo-1-like isoform X2 [Nicotiana tomentosiformis] Length = 211 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >ref|XP_009614462.1| PREDICTED: chromatin structure-remodeling complex subunit RSC1-like isoform X1 [Nicotiana tomentosiformis] Length = 216 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >ref|XP_009347851.1| PREDICTED: protein polybromo-1-like isoform X3 [Pyrus x bretschneideri] Length = 216 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 141 YCKCEMPYNPDDLMVQCEGCSDW 163 >ref|XP_009347850.1| PREDICTED: BAH and coiled-coil domain-containing protein 1-like isoform X2 [Pyrus x bretschneideri] Length = 231 Score = 61.2 bits (147), Expect = 9e-07 Identities = 23/23 (100%), Positives = 23/23 (100%) Frame = -2 Query: 910 YCKCEMPYNPDDLMVQCEGCSDW 842 YCKCEMPYNPDDLMVQCEGCSDW Sbjct: 156 YCKCEMPYNPDDLMVQCEGCSDW 178