BLASTX nr result
ID: Forsythia22_contig00036117
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00036117 (416 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_006359699.1| PREDICTED: WD-40 repeat-containing protein M... 85 2e-14 ref|XP_004231043.1| PREDICTED: WD-40 repeat-containing protein M... 85 2e-14 emb|CDP20641.1| unnamed protein product [Coffea canephora] 84 3e-14 ref|XP_009791634.1| PREDICTED: WD-40 repeat-containing protein M... 79 9e-13 ref|XP_012837187.1| PREDICTED: WD-40 repeat-containing protein M... 79 2e-12 gb|EPS63759.1| hypothetical protein M569_11022, partial [Genlise... 77 5e-12 ref|XP_009626746.1| PREDICTED: WD-40 repeat-containing protein M... 76 1e-11 ref|XP_011088610.1| PREDICTED: LOW QUALITY PROTEIN: WD-40 repeat... 74 4e-11 ref|XP_010266834.1| PREDICTED: WD-40 repeat-containing protein M... 74 5e-11 ref|XP_009418720.1| PREDICTED: histone-binding protein MSI1-like... 74 5e-11 ref|XP_006486738.1| PREDICTED: WD-40 repeat-containing protein M... 73 8e-11 ref|XP_006422592.1| hypothetical protein CICLE_v10028562mg [Citr... 73 8e-11 ref|XP_012449555.1| PREDICTED: WD-40 repeat-containing protein M... 72 1e-10 gb|KJB12143.1| hypothetical protein B456_002G002900 [Gossypium r... 72 1e-10 gb|KHF98932.1| WD-40 repeat-containing MSI2 -like protein [Gossy... 72 1e-10 gb|ABC79303.1| putative retinoblastoma binding protein [Gossypiu... 72 1e-10 ref|XP_010467407.1| PREDICTED: WD-40 repeat-containing protein M... 72 2e-10 ref|XP_010490354.1| PREDICTED: WD-40 repeat-containing protein M... 71 3e-10 ref|XP_010489265.1| PREDICTED: WD-40 repeat-containing protein M... 71 3e-10 ref|XP_009414440.1| PREDICTED: histone-binding protein MSI1-like... 71 3e-10 >ref|XP_006359699.1| PREDICTED: WD-40 repeat-containing protein MSI2-like [Solanum tuberosum] Length = 403 Score = 85.1 bits (209), Expect = 2e-14 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDDGPLAVH 3 F+VWKKNTPLLYDLVV HALEWPSLTVQWLPSP +DDG AVH Sbjct: 20 FAVWKKNTPLLYDLVVCHALEWPSLTVQWLPSPTTDDGAFAVH 62 >ref|XP_004231043.1| PREDICTED: WD-40 repeat-containing protein MSI2-like [Solanum lycopersicum] Length = 403 Score = 85.1 bits (209), Expect = 2e-14 Identities = 37/43 (86%), Positives = 39/43 (90%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDDGPLAVH 3 F+VWKKNTPLLYDLVV HALEWPSLTVQWLPSP +DDG AVH Sbjct: 20 FAVWKKNTPLLYDLVVCHALEWPSLTVQWLPSPTTDDGAFAVH 62 >emb|CDP20641.1| unnamed protein product [Coffea canephora] Length = 405 Score = 84.3 bits (207), Expect = 3e-14 Identities = 41/56 (73%), Positives = 42/56 (75%), Gaps = 1/56 (1%) Frame = -1 Query: 167 GEQGXXXXXXXEFSVWKKNTPLLYDLVVSHALEWPSLTVQWLP-SPPSDDGPLAVH 3 G G EFSVWKKNTP LYDLV+SHALEWPSLTVQWLP PP DGPLAVH Sbjct: 8 GAAGGDEMVEEEFSVWKKNTPFLYDLVISHALEWPSLTVQWLPLPPPLHDGPLAVH 63 >ref|XP_009791634.1| PREDICTED: WD-40 repeat-containing protein MSI2-like [Nicotiana sylvestris] Length = 403 Score = 79.3 bits (194), Expect = 9e-13 Identities = 34/43 (79%), Positives = 36/43 (83%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDDGPLAVH 3 FSVWKKNTPLLYDLV+ HALEWPSLTVQWLPSP D+G H Sbjct: 20 FSVWKKNTPLLYDLVICHALEWPSLTVQWLPSPAVDNGSFLTH 62 >ref|XP_012837187.1| PREDICTED: WD-40 repeat-containing protein MSI2-like [Erythranthe guttatus] Length = 402 Score = 78.6 bits (192), Expect = 2e-12 Identities = 36/44 (81%), Positives = 38/44 (86%), Gaps = 1/44 (2%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDD-GPLAVH 3 F VWK NTPLLYDLV+ H+LEWPSLTVQWLPSPPS D G LAVH Sbjct: 15 FLVWKMNTPLLYDLVIFHSLEWPSLTVQWLPSPPSSDGGDLAVH 58 >gb|EPS63759.1| hypothetical protein M569_11022, partial [Genlisea aurea] Length = 390 Score = 77.0 bits (188), Expect = 5e-12 Identities = 36/44 (81%), Positives = 37/44 (84%), Gaps = 1/44 (2%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDD-GPLAVH 3 FSVWKKNTPLLYDL+VSHALEWPSLTVQWLP PPS L VH Sbjct: 7 FSVWKKNTPLLYDLLVSHALEWPSLTVQWLPLPPSSSAADLEVH 50 >ref|XP_009626746.1| PREDICTED: WD-40 repeat-containing protein MSI2-like [Nicotiana tomentosiformis] Length = 403 Score = 75.9 bits (185), Expect = 1e-11 Identities = 33/43 (76%), Positives = 34/43 (79%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDDGPLAVH 3 FSVWKKNTPLLYDLV+ HALEWPSLTVQWLPS D G H Sbjct: 20 FSVWKKNTPLLYDLVICHALEWPSLTVQWLPSAAVDSGSFLTH 62 >ref|XP_011088610.1| PREDICTED: LOW QUALITY PROTEIN: WD-40 repeat-containing protein MSI3 [Sesamum indicum] Length = 393 Score = 73.9 bits (180), Expect = 4e-11 Identities = 35/43 (81%), Positives = 37/43 (86%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDDGPLAVH 3 FSVWKKNTPLLYDLV+ H+LEWPSLTVQ LP P SD G LAVH Sbjct: 9 FSVWKKNTPLLYDLVICHSLEWPSLTVQXLP-PSSDGGDLAVH 50 >ref|XP_010266834.1| PREDICTED: WD-40 repeat-containing protein MSI2-like [Nelumbo nucifera] Length = 400 Score = 73.6 bits (179), Expect = 5e-11 Identities = 34/46 (73%), Positives = 37/46 (80%), Gaps = 3/46 (6%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPP---SDDGPLAVH 3 FSVWKKNTP LYDLV+SHAL WPSLTVQWLPS P ++D AVH Sbjct: 16 FSVWKKNTPFLYDLVISHALVWPSLTVQWLPSLPQTDAEDASFAVH 61 >ref|XP_009418720.1| PREDICTED: histone-binding protein MSI1-like [Musa acuminata subsp. malaccensis] Length = 407 Score = 73.6 bits (179), Expect = 5e-11 Identities = 32/43 (74%), Positives = 34/43 (79%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDDGPLAVH 3 + VWKKNTP LYDLV+SHALEWPSLTVQWLPS S G A H Sbjct: 22 YPVWKKNTPFLYDLVISHALEWPSLTVQWLPSSSSSCGSAATH 64 >ref|XP_006486738.1| PREDICTED: WD-40 repeat-containing protein MSI3-like [Citrus sinensis] gi|641849197|gb|KDO68072.1| hypothetical protein CISIN_1g015484mg [Citrus sinensis] Length = 406 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/46 (71%), Positives = 36/46 (78%), Gaps = 3/46 (6%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPP---SDDGPLAVH 3 F+VWKKNTP LYDL+VSH LEWPSLTV W+PSPP S D AVH Sbjct: 17 FTVWKKNTPFLYDLIVSHPLEWPSLTVHWVPSPPQPYSADPTFAVH 62 >ref|XP_006422592.1| hypothetical protein CICLE_v10028562mg [Citrus clementina] gi|557524526|gb|ESR35832.1| hypothetical protein CICLE_v10028562mg [Citrus clementina] Length = 406 Score = 72.8 bits (177), Expect = 8e-11 Identities = 33/46 (71%), Positives = 36/46 (78%), Gaps = 3/46 (6%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPP---SDDGPLAVH 3 F+VWKKNTP LYDL+VSH LEWPSLTV W+PSPP S D AVH Sbjct: 17 FTVWKKNTPFLYDLIVSHPLEWPSLTVHWVPSPPQPYSADPTFAVH 62 >ref|XP_012449555.1| PREDICTED: WD-40 repeat-containing protein MSI3 [Gossypium raimondii] gi|763744706|gb|KJB12145.1| hypothetical protein B456_002G002900 [Gossypium raimondii] Length = 410 Score = 72.0 bits (175), Expect = 1e-10 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDDGP 15 FSVWKKNTP LYDLV+SH LEWPSLTV W+PS P+ GP Sbjct: 16 FSVWKKNTPFLYDLVISHPLEWPSLTVHWVPSSPTPYGP 54 >gb|KJB12143.1| hypothetical protein B456_002G002900 [Gossypium raimondii] Length = 335 Score = 72.0 bits (175), Expect = 1e-10 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDDGP 15 FSVWKKNTP LYDLV+SH LEWPSLTV W+PS P+ GP Sbjct: 16 FSVWKKNTPFLYDLVISHPLEWPSLTVHWVPSSPTPYGP 54 >gb|KHF98932.1| WD-40 repeat-containing MSI2 -like protein [Gossypium arboreum] Length = 410 Score = 72.0 bits (175), Expect = 1e-10 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDDGP 15 FSVWKKNTP LYDLV+SH LEWPSLTV W+PS P+ GP Sbjct: 16 FSVWKKNTPFLYDLVISHPLEWPSLTVHWVPSSPTPYGP 54 >gb|ABC79303.1| putative retinoblastoma binding protein [Gossypium hirsutum] Length = 410 Score = 72.0 bits (175), Expect = 1e-10 Identities = 30/39 (76%), Positives = 33/39 (84%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDDGP 15 FSVWKKNTP LYDLV+SH LEWPSLTV W+PS P+ GP Sbjct: 16 FSVWKKNTPFLYDLVISHPLEWPSLTVHWVPSSPTPYGP 54 >ref|XP_010467407.1| PREDICTED: WD-40 repeat-containing protein MSI2-like [Camelina sativa] Length = 416 Score = 71.6 bits (174), Expect = 2e-10 Identities = 29/35 (82%), Positives = 32/35 (91%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPS 27 FSVWKKNTP LYDL++SH LEWPSLTV W+PSPPS Sbjct: 18 FSVWKKNTPFLYDLLISHPLEWPSLTVNWVPSPPS 52 >ref|XP_010490354.1| PREDICTED: WD-40 repeat-containing protein MSI2-like [Camelina sativa] Length = 278 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDDGPLA 9 FSVWKKNTP LYDL++SH LEWPSLTV W+PSPP GP A Sbjct: 18 FSVWKKNTPFLYDLLISHPLEWPSLTVHWVPSPP---GPYA 55 >ref|XP_010489265.1| PREDICTED: WD-40 repeat-containing protein MSI2 [Camelina sativa] Length = 416 Score = 70.9 bits (172), Expect = 3e-10 Identities = 31/41 (75%), Positives = 34/41 (82%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDDGPLA 9 FSVWKKNTP LYDL++SH LEWPSLTV W+PSPP GP A Sbjct: 18 FSVWKKNTPFLYDLLISHPLEWPSLTVHWVPSPP---GPYA 55 >ref|XP_009414440.1| PREDICTED: histone-binding protein MSI1-like [Musa acuminata subsp. malaccensis] Length = 404 Score = 70.9 bits (172), Expect = 3e-10 Identities = 30/38 (78%), Positives = 32/38 (84%) Frame = -1 Query: 131 FSVWKKNTPLLYDLVVSHALEWPSLTVQWLPSPPSDDG 18 + VWKKNTP LYDLV+SHALEWPSLTVQWLPS S G Sbjct: 18 YRVWKKNTPFLYDLVISHALEWPSLTVQWLPSSSSSSG 55