BLASTX nr result
ID: Forsythia22_contig00035892
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00035892 (365 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011098929.1| PREDICTED: probable protein S-acyltransferas... 64 5e-08 ref|XP_012844033.1| PREDICTED: probable protein S-acyltransferas... 56 8e-06 >ref|XP_011098929.1| PREDICTED: probable protein S-acyltransferase 7 [Sesamum indicum] Length = 437 Score = 63.5 bits (153), Expect = 5e-08 Identities = 31/39 (79%), Positives = 34/39 (87%) Frame = -3 Query: 363 RKSGSWDMSPEVLALASRMGESNPTGGTSSTIRPT*TKL 247 RKSGSW+MSPEVLALASRMGE N TGG+SST+R T KL Sbjct: 399 RKSGSWEMSPEVLALASRMGEPNRTGGSSSTVRSTEPKL 437 >ref|XP_012844033.1| PREDICTED: probable protein S-acyltransferase 7 [Erythranthe guttatus] gi|604321263|gb|EYU31851.1| hypothetical protein MIMGU_mgv1a006331mg [Erythranthe guttata] Length = 448 Score = 56.2 bits (134), Expect = 8e-06 Identities = 30/40 (75%), Positives = 33/40 (82%), Gaps = 1/40 (2%) Frame = -3 Query: 363 RKSGSWDMSPEVLALASRM-GESNPTGGTSSTIRPT*TKL 247 RKSGSW+MSPEVLALASRM GE N T G+SST+R T KL Sbjct: 409 RKSGSWEMSPEVLALASRMGGEPNRTAGSSSTVRSTEHKL 448