BLASTX nr result
ID: Forsythia22_contig00035849
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00035849 (253 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011082894.1| PREDICTED: glucose-1-phosphate adenylyltrans... 58 2e-06 >ref|XP_011082894.1| PREDICTED: glucose-1-phosphate adenylyltransferase small subunit, chloroplastic/amyloplastic [Sesamum indicum] Length = 523 Score = 58.2 bits (139), Expect = 2e-06 Identities = 37/74 (50%), Positives = 47/74 (63%), Gaps = 2/74 (2%) Frame = -1 Query: 217 MATTGVLKLXXXXXXXXXXSFKRVEDVKS--FTRLSFAASNVAGKELASSAAVQLQRRRS 44 MA T VL+L + VEDV S FTRLSFAASNVAG+ L SS V+++R+RS Sbjct: 1 MAATAVLRLVPNATVVVNH--RGVEDVNSASFTRLSFAASNVAGESLKSSRQVRVRRQRS 58 Query: 43 KTEFVNRSPLIVSP 2 + +R P+IVSP Sbjct: 59 GGDLESRGPMIVSP 72