BLASTX nr result
ID: Forsythia22_contig00035807
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00035807 (348 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|EYU38411.1| hypothetical protein MIMGU_mgv1a021572mg [Erythra... 60 7e-07 >gb|EYU38411.1| hypothetical protein MIMGU_mgv1a021572mg [Erythranthe guttata] Length = 99 Score = 59.7 bits (143), Expect = 7e-07 Identities = 32/58 (55%), Positives = 38/58 (65%), Gaps = 2/58 (3%) Frame = -3 Query: 259 RWIDTSFSLPTSFFRWLRLFTSCFT--STWSSGFNLSSFTTSLEPRRLASLLRFPDLD 92 RW+D SFSLPTSFFRW RLFTS T WSS +L+ SL+P R A + PD+D Sbjct: 14 RWLDVSFSLPTSFFRWPRLFTSYLTPPPRWSSSLSLA--LGSLDPGRWAPRIPLPDVD 69