BLASTX nr result
ID: Forsythia22_contig00035802
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00035802 (262 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KDO58794.1| hypothetical protein CISIN_1g042025mg [Citrus sin... 63 9e-08 ref|XP_006432663.1| hypothetical protein CICLE_v10000243mg [Citr... 63 9e-08 emb|CDY22573.1| BnaC05g24110D [Brassica napus] 62 1e-07 ref|XP_009373496.1| PREDICTED: extra-large guanine nucleotide-bi... 62 2e-07 ref|XP_008373519.1| PREDICTED: extra-large guanine nucleotide-bi... 62 2e-07 ref|XP_012081049.1| PREDICTED: extra-large guanine nucleotide-bi... 62 2e-07 ref|XP_002518995.1| GTP-binding protein alpha subunit, gna, put... 62 2e-07 ref|XP_009766588.1| PREDICTED: extra-large guanine nucleotide-bi... 62 2e-07 ref|XP_008238142.1| PREDICTED: extra-large guanine nucleotide-bi... 62 2e-07 ref|XP_007210372.1| hypothetical protein PRUPE_ppa001297mg [Prun... 62 2e-07 ref|XP_010110392.1| Guanine nucleotide-binding protein alpha-2 s... 61 3e-07 ref|XP_011082318.1| PREDICTED: extra-large guanine nucleotide-bi... 61 3e-07 ref|XP_009591555.1| PREDICTED: extra-large guanine nucleotide-bi... 61 3e-07 ref|XP_004244413.1| PREDICTED: extra-large guanine nucleotide-bi... 61 3e-07 ref|XP_011018462.1| PREDICTED: extra-large guanine nucleotide-bi... 61 3e-07 ref|XP_010540731.1| PREDICTED: extra-large guanine nucleotide-bi... 61 3e-07 ref|XP_010478615.1| PREDICTED: extra-large guanine nucleotide-bi... 61 3e-07 ref|XP_010499742.1| PREDICTED: extra-large guanine nucleotide-bi... 61 3e-07 ref|XP_008367614.1| PREDICTED: extra-large guanine nucleotide-bi... 61 3e-07 ref|NP_174475.1| extra-large GTP-binding protein 3 [Arabidopsis ... 61 3e-07 >gb|KDO58794.1| hypothetical protein CISIN_1g042025mg [Citrus sinensis] Length = 844 Score = 62.8 bits (151), Expect = 9e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKFT EELQDIKLMIQSN+YRYLSIL Sbjct: 446 KQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSIL 479 >ref|XP_006432663.1| hypothetical protein CICLE_v10000243mg [Citrus clementina] gi|567880211|ref|XP_006432664.1| hypothetical protein CICLE_v10000243mg [Citrus clementina] gi|567880215|ref|XP_006432666.1| hypothetical protein CICLE_v10000243mg [Citrus clementina] gi|568834743|ref|XP_006471469.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X1 [Citrus sinensis] gi|568834745|ref|XP_006471470.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X2 [Citrus sinensis] gi|568834747|ref|XP_006471471.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X3 [Citrus sinensis] gi|568834749|ref|XP_006471472.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like isoform X4 [Citrus sinensis] gi|557534785|gb|ESR45903.1| hypothetical protein CICLE_v10000243mg [Citrus clementina] gi|557534786|gb|ESR45904.1| hypothetical protein CICLE_v10000243mg [Citrus clementina] gi|557534788|gb|ESR45906.1| hypothetical protein CICLE_v10000243mg [Citrus clementina] Length = 866 Score = 62.8 bits (151), Expect = 9e-08 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKFT EELQDIKLMIQSN+YRYLSIL Sbjct: 468 KQAKFLYGNKFTAEELQDIKLMIQSNMYRYLSIL 501 >emb|CDY22573.1| BnaC05g24110D [Brassica napus] Length = 841 Score = 62.4 bits (150), Expect = 1e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKFT EELQDIKLM+QSN+YRYLSIL Sbjct: 443 KQAKFLYGNKFTVEELQDIKLMVQSNMYRYLSIL 476 >ref|XP_009373496.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Pyrus x bretschneideri] gi|694396433|ref|XP_009373497.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Pyrus x bretschneideri] gi|694396435|ref|XP_009373498.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Pyrus x bretschneideri] Length = 860 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKFT+EELQDIKLMIQSN+Y+YLSIL Sbjct: 463 KQAKFLYGNKFTSEELQDIKLMIQSNMYKYLSIL 496 >ref|XP_008373519.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Malus domestica] gi|657963803|ref|XP_008373520.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Malus domestica] Length = 860 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/34 (85%), Positives = 33/34 (97%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKFT+EELQDIKLMIQSN+Y+YLSIL Sbjct: 462 KQAKFLYGNKFTSEELQDIKLMIQSNMYKYLSIL 495 >ref|XP_012081049.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Jatropha curcas] gi|643719601|gb|KDP30366.1| hypothetical protein JCGZ_17095 [Jatropha curcas] Length = 863 Score = 62.0 bits (149), Expect = 2e-07 Identities = 30/34 (88%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKFT EELQDIKLMIQSN+YRYLSIL Sbjct: 465 KQAKFLYGNKFTGEELQDIKLMIQSNMYRYLSIL 498 >ref|XP_002518995.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] gi|223541982|gb|EEF43528.1| GTP-binding protein alpha subunit, gna, putative [Ricinus communis] Length = 1203 Score = 62.0 bits (149), Expect = 2e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK +YGNKFT EELQDIKLMIQSN+YRYLSIL Sbjct: 462 KQAKFMYGNKFTAEELQDIKLMIQSNMYRYLSIL 495 >ref|XP_009766588.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Nicotiana sylvestris] Length = 845 Score = 61.6 bits (148), Expect = 2e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKFT EE+QDIKLMIQSN+Y+YLSIL Sbjct: 455 KQAKFLYGNKFTAEEIQDIKLMIQSNIYKYLSIL 488 >ref|XP_008238142.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] gi|645265422|ref|XP_008238143.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] gi|645265424|ref|XP_008238144.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] gi|645265427|ref|XP_008238145.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] gi|645265429|ref|XP_008238146.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] gi|645265431|ref|XP_008238147.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Prunus mume] Length = 861 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKFT EELQDIKLMIQSN+Y+YLSIL Sbjct: 463 KQAKFLYGNKFTAEELQDIKLMIQSNMYKYLSIL 496 >ref|XP_007210372.1| hypothetical protein PRUPE_ppa001297mg [Prunus persica] gi|462406107|gb|EMJ11571.1| hypothetical protein PRUPE_ppa001297mg [Prunus persica] Length = 861 Score = 61.6 bits (148), Expect = 2e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKFT EELQDIKLMIQSN+Y+YLSIL Sbjct: 463 KQAKFLYGNKFTAEELQDIKLMIQSNMYKYLSIL 496 >ref|XP_010110392.1| Guanine nucleotide-binding protein alpha-2 subunit [Morus notabilis] gi|587939580|gb|EXC26224.1| Guanine nucleotide-binding protein alpha-2 subunit [Morus notabilis] Length = 859 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKFT EELQDIKLMIQSN+Y+YLSIL Sbjct: 461 KQAKFLYGNKFTPEELQDIKLMIQSNMYKYLSIL 494 >ref|XP_011082318.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Sesamum indicum] Length = 861 Score = 61.2 bits (147), Expect = 3e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKFT EELQDIKLMIQSN+Y+YLSIL Sbjct: 463 KQAKFLYGNKFTPEELQDIKLMIQSNMYKYLSIL 496 >ref|XP_009591555.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Nicotiana tomentosiformis] Length = 845 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKFT EE+QDIKLMIQSN+Y+YLSIL Sbjct: 455 KQAKFLYGNKFTPEEIQDIKLMIQSNIYKYLSIL 488 >ref|XP_004244413.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Solanum lycopersicum] gi|723719278|ref|XP_010324472.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Solanum lycopersicum] Length = 850 Score = 61.2 bits (147), Expect = 3e-07 Identities = 28/34 (82%), Positives = 33/34 (97%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK+LYGNKFT EE+QDIKLMIQSN+Y+YLSIL Sbjct: 458 KQAKLLYGNKFTNEEVQDIKLMIQSNMYKYLSIL 491 >ref|XP_011018462.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Populus euphratica] gi|743809250|ref|XP_011018463.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Populus euphratica] Length = 861 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYG+KFT EELQDIKLMIQSN+YRYLSIL Sbjct: 463 KQAKFLYGSKFTAEELQDIKLMIQSNMYRYLSIL 496 >ref|XP_010540731.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Tarenaya hassleriana] Length = 848 Score = 60.8 bits (146), Expect = 3e-07 Identities = 29/34 (85%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKF+ EELQDIKLMIQSN+YRYLSIL Sbjct: 458 KQAKFLYGNKFSLEELQDIKLMIQSNMYRYLSIL 491 >ref|XP_010478615.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Camelina sativa] gi|727610929|ref|XP_010478616.1| PREDICTED: extra-large guanine nucleotide-binding protein 3 [Camelina sativa] Length = 858 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKF+ EELQDIKLM+QSN+YRYLSIL Sbjct: 454 KQAKFLYGNKFSVEELQDIKLMVQSNMYRYLSIL 487 >ref|XP_010499742.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Camelina sativa] gi|727436851|ref|XP_010499743.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Camelina sativa] Length = 852 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKF+ EELQDIKLM+QSN+YRYLSIL Sbjct: 448 KQAKFLYGNKFSVEELQDIKLMVQSNMYRYLSIL 481 >ref|XP_008367614.1| PREDICTED: extra-large guanine nucleotide-binding protein 3-like [Malus domestica] Length = 875 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/34 (82%), Positives = 34/34 (100%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK+LYGNKFT+EELQ+IKLMIQSN+Y+YLSIL Sbjct: 486 KQAKLLYGNKFTSEELQNIKLMIQSNMYKYLSIL 519 >ref|NP_174475.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gi|30692624|ref|NP_849737.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gi|334182982|ref|NP_001185125.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gi|75168876|sp|Q9C516.1|XLG3_ARATH RecName: Full=Extra-large guanine nucleotide-binding protein 3; AltName: Full=Extra-large GTP-binding protein 3; Short=Extra-large G-protein 3 gi|12321289|gb|AAG50710.1|AC079041_3 G-protein, putative [Arabidopsis thaliana] gi|12321467|gb|AAG50792.1|AC074309_9 G-protein alpha subunit, putative [Arabidopsis thaliana] gi|110738987|dbj|BAF01414.1| hypothetical protein [Arabidopsis thaliana] gi|222423921|dbj|BAH19924.1| AT1G31930 [Arabidopsis thaliana] gi|222424740|dbj|BAH20323.1| AT1G31930 [Arabidopsis thaliana] gi|251737921|gb|ACT10805.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gi|332193296|gb|AEE31417.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gi|332193297|gb|AEE31418.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] gi|332193298|gb|AEE31419.1| extra-large GTP-binding protein 3 [Arabidopsis thaliana] Length = 848 Score = 60.8 bits (146), Expect = 3e-07 Identities = 28/34 (82%), Positives = 32/34 (94%) Frame = +3 Query: 159 EQAKVLYGNKFTTEELQDIKLMIQSNVYRYLSIL 260 +QAK LYGNKF+ EELQDIKLM+QSN+YRYLSIL Sbjct: 448 KQAKFLYGNKFSVEELQDIKLMVQSNMYRYLSIL 481