BLASTX nr result
ID: Forsythia22_contig00035770
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00035770 (324 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] 99 9e-19 ref|XP_002535169.1| conserved hypothetical protein [Ricinus comm... 91 3e-16 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 99.4 bits (246), Expect = 9e-19 Identities = 46/48 (95%), Positives = 47/48 (97%), Gaps = 1/48 (2%) Frame = +1 Query: 19 HF-PSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVLRLFGRHG 159 HF PSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVL+LFGRHG Sbjct: 556 HFVPSCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVLKLFGRHG 603 >ref|XP_002535169.1| conserved hypothetical protein [Ricinus communis] gi|223523841|gb|EEF27214.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 90.9 bits (224), Expect = 3e-16 Identities = 42/45 (93%), Positives = 44/45 (97%) Frame = -1 Query: 174 LHRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSHRSARFVLISD 40 L+RAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTS+RSARFVLI D Sbjct: 40 LYRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSYRSARFVLIPD 84