BLASTX nr result
ID: Forsythia22_contig00035755
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00035755 (218 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011047567.1| PREDICTED: bax inhibitor 1-like [Populus eup... 57 6e-06 ref|XP_006368952.1| Bax inhibitor-1 family protein [Populus tric... 57 6e-06 >ref|XP_011047567.1| PREDICTED: bax inhibitor 1-like [Populus euphratica] Length = 247 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 128 MDTFASFFDSKSASGNRWTYDSLKNLRQIS 217 MD FASFFDS+SAS NRW+YDSLKNLRQIS Sbjct: 1 MDAFASFFDSQSASRNRWSYDSLKNLRQIS 30 >ref|XP_006368952.1| Bax inhibitor-1 family protein [Populus trichocarpa] gi|550347311|gb|ERP65521.1| Bax inhibitor-1 family protein [Populus trichocarpa] Length = 247 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +2 Query: 128 MDTFASFFDSKSASGNRWTYDSLKNLRQIS 217 MD FASFFDS+SAS NRW+YDSLKNLRQIS Sbjct: 1 MDAFASFFDSQSASRNRWSYDSLKNLRQIS 30