BLASTX nr result
ID: Forsythia22_contig00035724
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00035724 (325 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_011089073.1| PREDICTED: ethylene-responsive transcription... 84 3e-14 ref|XP_011089071.1| PREDICTED: ethylene-responsive transcription... 84 3e-14 ref|XP_011089070.1| PREDICTED: ethylene-responsive transcription... 84 3e-14 ref|XP_011089069.1| PREDICTED: ethylene-responsive transcription... 84 3e-14 ref|XP_011089068.1| PREDICTED: ethylene-responsive transcription... 84 3e-14 ref|XP_011089662.1| PREDICTED: ethylene-responsive transcription... 77 3e-12 ref|XP_010242671.1| PREDICTED: ethylene-responsive transcription... 70 4e-10 ref|XP_010242670.1| PREDICTED: ethylene-responsive transcription... 70 4e-10 ref|XP_011024614.1| PREDICTED: ethylene-responsive transcription... 69 2e-09 ref|XP_002536393.1| conserved hypothetical protein [Ricinus comm... 69 2e-09 ref|XP_006386876.1| hypothetical protein POPTR_0002s24750g [Popu... 69 2e-09 ref|XP_003635007.2| PREDICTED: ethylene-responsive transcription... 68 3e-09 emb|CBI29409.3| unnamed protein product [Vitis vinifera] 68 3e-09 emb|CAN81560.1| hypothetical protein VITISV_009902 [Vitis vinifera] 68 3e-09 ref|XP_012085059.1| PREDICTED: ethylene-responsive transcription... 67 4e-09 ref|XP_012833547.1| PREDICTED: ethylene-responsive transcription... 67 5e-09 ref|XP_012833548.1| PREDICTED: ethylene-responsive transcription... 67 5e-09 ref|XP_012085054.1| PREDICTED: ethylene-responsive transcription... 62 1e-07 ref|XP_010696270.1| PREDICTED: ethylene-responsive transcription... 62 2e-07 ref|XP_010696269.1| PREDICTED: ethylene-responsive transcription... 62 2e-07 >ref|XP_011089073.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X5 [Sesamum indicum] Length = 217 Score = 84.3 bits (207), Expect = 3e-14 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGKPQNNDWDGEQGRSGFSASEDDPL 160 RKFKW++FLA+TRSAIT+KKSQRR+G R K + N+W+GEQGR+GFSASEDD L Sbjct: 161 RKFKWDEFLAMTRSAITNKKSQRRSGTVPRRKFEENEWEGEQGRNGFSASEDDAL 215 >ref|XP_011089071.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X4 [Sesamum indicum] gi|747083413|ref|XP_011089072.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X4 [Sesamum indicum] Length = 223 Score = 84.3 bits (207), Expect = 3e-14 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGKPQNNDWDGEQGRSGFSASEDDPL 160 RKFKW++FLA+TRSAIT+KKSQRR+G R K + N+W+GEQGR+GFSASEDD L Sbjct: 167 RKFKWDEFLAMTRSAITNKKSQRRSGTVPRRKFEENEWEGEQGRNGFSASEDDAL 221 >ref|XP_011089070.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X3 [Sesamum indicum] Length = 230 Score = 84.3 bits (207), Expect = 3e-14 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGKPQNNDWDGEQGRSGFSASEDDPL 160 RKFKW++FLA+TRSAIT+KKSQRR+G R K + N+W+GEQGR+GFSASEDD L Sbjct: 174 RKFKWDEFLAMTRSAITNKKSQRRSGTVPRRKFEENEWEGEQGRNGFSASEDDAL 228 >ref|XP_011089069.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X2 [Sesamum indicum] Length = 232 Score = 84.3 bits (207), Expect = 3e-14 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGKPQNNDWDGEQGRSGFSASEDDPL 160 RKFKW++FLA+TRSAIT+KKSQRR+G R K + N+W+GEQGR+GFSASEDD L Sbjct: 176 RKFKWDEFLAMTRSAITNKKSQRRSGTVPRRKFEENEWEGEQGRNGFSASEDDAL 230 >ref|XP_011089068.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Sesamum indicum] Length = 240 Score = 84.3 bits (207), Expect = 3e-14 Identities = 39/55 (70%), Positives = 48/55 (87%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGKPQNNDWDGEQGRSGFSASEDDPL 160 RKFKW++FLA+TRSAIT+KKSQRR+G R K + N+W+GEQGR+GFSASEDD L Sbjct: 184 RKFKWDEFLAMTRSAITNKKSQRRSGTVPRRKFEENEWEGEQGRNGFSASEDDAL 238 >ref|XP_011089662.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Sesamum indicum] gi|747084499|ref|XP_011089663.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Sesamum indicum] Length = 223 Score = 77.4 bits (189), Expect = 3e-12 Identities = 36/52 (69%), Positives = 43/52 (82%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGKPQNNDWDGEQGRSGFSASED 169 RK+KW++FLAITRSAIT+KK QRRTGPG R K N++W GE G+S SASED Sbjct: 167 RKYKWDEFLAITRSAITNKKGQRRTGPGSRRKSLNDEWAGEPGQSTSSASED 218 >ref|XP_010242671.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X2 [Nelumbo nucifera] Length = 185 Score = 70.5 bits (171), Expect = 4e-10 Identities = 35/56 (62%), Positives = 41/56 (73%), Gaps = 4/56 (7%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGK----PQNNDWDGEQGRSGFSASED 169 R+FKWE+FL +TRSAIT+KK QRR G G R K Q+ DW+GEQG G SASED Sbjct: 122 RRFKWEEFLTMTRSAITNKKHQRRLGAGSRKKSETPAQSGDWEGEQGVGGHSASED 177 >ref|XP_010242670.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Nelumbo nucifera] Length = 232 Score = 70.5 bits (171), Expect = 4e-10 Identities = 35/56 (62%), Positives = 41/56 (73%), Gaps = 4/56 (7%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGK----PQNNDWDGEQGRSGFSASED 169 R+FKWE+FL +TRSAIT+KK QRR G G R K Q+ DW+GEQG G SASED Sbjct: 169 RRFKWEEFLTMTRSAITNKKHQRRLGAGSRKKSETPAQSGDWEGEQGVGGHSASED 224 >ref|XP_011024614.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Populus euphratica] gi|743833767|ref|XP_011024615.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Populus euphratica] gi|743833771|ref|XP_011024616.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Populus euphratica] gi|743833775|ref|XP_011024617.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Populus euphratica] gi|743833779|ref|XP_011024618.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Populus euphratica] gi|743833782|ref|XP_011024619.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Populus euphratica] Length = 232 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 4/56 (7%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGKP----QNNDWDGEQGRSGFSASED 169 RKFKW++FLAITRSAI +KK +RR G GL+ + Q+ DWD + G +GFSASED Sbjct: 169 RKFKWDEFLAITRSAINNKKHKRRIGAGLQKRSETTLQDGDWDAKDGLNGFSASED 224 >ref|XP_002536393.1| conserved hypothetical protein [Ricinus communis] gi|223519852|gb|EEF25990.1| conserved hypothetical protein, partial [Ricinus communis] Length = 91 Score = 68.6 bits (166), Expect = 2e-09 Identities = 36/56 (64%), Positives = 44/56 (78%), Gaps = 4/56 (7%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGL--RGKP--QNNDWDGEQGRSGFSASED 169 RKFKW++FLAITRSAI +KK +RR+G GL R +P QN DWDG+QG + SASED Sbjct: 28 RKFKWDEFLAITRSAINNKKHKRRSGAGLQKRCEPELQNGDWDGKQGVNSPSASED 83 >ref|XP_006386876.1| hypothetical protein POPTR_0002s24750g [Populus trichocarpa] gi|566159814|ref|XP_006386877.1| hypothetical protein POPTR_0002s24750g [Populus trichocarpa] gi|566159817|ref|XP_002303060.2| hypothetical protein POPTR_0002s24750g [Populus trichocarpa] gi|566159819|ref|XP_006386878.1| hypothetical protein POPTR_0002s24750g [Populus trichocarpa] gi|550345757|gb|ERP64673.1| hypothetical protein POPTR_0002s24750g [Populus trichocarpa] gi|550345758|gb|ERP64674.1| hypothetical protein POPTR_0002s24750g [Populus trichocarpa] gi|550345759|gb|EEE82333.2| hypothetical protein POPTR_0002s24750g [Populus trichocarpa] gi|550345760|gb|ERP64675.1| hypothetical protein POPTR_0002s24750g [Populus trichocarpa] Length = 232 Score = 68.6 bits (166), Expect = 2e-09 Identities = 33/56 (58%), Positives = 42/56 (75%), Gaps = 4/56 (7%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGKP----QNNDWDGEQGRSGFSASED 169 RKFKW++FLAITRSAI +KK +RR G GL+ + Q+ DWD + G +GFSASED Sbjct: 169 RKFKWDEFLAITRSAINNKKHKRRIGAGLQKRSETTLQDGDWDAKDGLNGFSASED 224 >ref|XP_003635007.2| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 [Vitis vinifera] Length = 163 Score = 67.8 bits (164), Expect = 3e-09 Identities = 35/56 (62%), Positives = 45/56 (80%), Gaps = 4/56 (7%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLR--GKP--QNNDWDGEQGRSGFSASED 169 R+FKWE+FLA+TR AIT+KK +RR G GL+ +P QN+D +GEQG +GFSASED Sbjct: 100 RQFKWEEFLAMTRHAITNKKHKRRLGAGLQKHSEPPQQNSDVEGEQGTNGFSASED 155 >emb|CBI29409.3| unnamed protein product [Vitis vinifera] Length = 157 Score = 67.8 bits (164), Expect = 3e-09 Identities = 35/56 (62%), Positives = 45/56 (80%), Gaps = 4/56 (7%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLR--GKP--QNNDWDGEQGRSGFSASED 169 R+FKWE+FLA+TR AIT+KK +RR G GL+ +P QN+D +GEQG +GFSASED Sbjct: 94 RQFKWEEFLAMTRHAITNKKHKRRLGAGLQKHSEPPQQNSDVEGEQGTNGFSASED 149 >emb|CAN81560.1| hypothetical protein VITISV_009902 [Vitis vinifera] Length = 232 Score = 67.8 bits (164), Expect = 3e-09 Identities = 35/56 (62%), Positives = 45/56 (80%), Gaps = 4/56 (7%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLR--GKP--QNNDWDGEQGRSGFSASED 169 R+FKWE+FLA+TR AIT+KK +RR G GL+ +P QN+D +GEQG +GFSASED Sbjct: 169 RQFKWEEFLAMTRHAITNKKHKRRLGAGLQKHSEPPQQNSDVEGEQGTNGFSASED 224 >ref|XP_012085059.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X2 [Jatropha curcas] gi|643713689|gb|KDP26354.1| hypothetical protein JCGZ_17512 [Jatropha curcas] Length = 232 Score = 67.4 bits (163), Expect = 4e-09 Identities = 34/56 (60%), Positives = 40/56 (71%), Gaps = 4/56 (7%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGKP----QNNDWDGEQGRSGFSASED 169 RKFKW++FLAITRSAI +KK +RR G L K QN DWD +QG + FSASED Sbjct: 169 RKFKWDEFLAITRSAINNKKHKRRNGASLPKKSEATLQNGDWDDKQGVNSFSASED 224 >ref|XP_012833547.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Erythranthe guttatus] Length = 216 Score = 67.0 bits (162), Expect = 5e-09 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGKPQNNDWDGEQGRSGFSASEDD 166 RK+KW++FLA+TRS+IT+KK QRRTG G R K QN+ E G SG SASEDD Sbjct: 164 RKYKWDEFLAMTRSSITNKKVQRRTGSGSRRKSQND----EHGYSGLSASEDD 212 >ref|XP_012833548.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X2 [Erythranthe guttatus] gi|848865714|ref|XP_012833549.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X2 [Erythranthe guttatus] gi|604341274|gb|EYU40626.1| hypothetical protein MIMGU_mgv1a013855mg [Erythranthe guttata] Length = 208 Score = 67.0 bits (162), Expect = 5e-09 Identities = 34/53 (64%), Positives = 41/53 (77%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGKPQNNDWDGEQGRSGFSASEDD 166 RK+KW++FLA+TRS+IT+KK QRRTG G R K QN+ E G SG SASEDD Sbjct: 156 RKYKWDEFLAMTRSSITNKKVQRRTGSGSRRKSQND----EHGYSGLSASEDD 204 >ref|XP_012085054.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Jatropha curcas] gi|802716588|ref|XP_012085055.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Jatropha curcas] gi|802716591|ref|XP_012085057.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Jatropha curcas] gi|802716594|ref|XP_012085058.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Jatropha curcas] Length = 234 Score = 62.4 bits (150), Expect = 1e-07 Identities = 34/58 (58%), Positives = 40/58 (68%), Gaps = 6/58 (10%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSK--KSQRRTGPGLRGKP----QNNDWDGEQGRSGFSASED 169 RKFKW++FLAITRSAI +K K +RR G L K QN DWD +QG + FSASED Sbjct: 169 RKFKWDEFLAITRSAINNKSNKHKRRNGASLPKKSEATLQNGDWDDKQGVNSFSASED 226 >ref|XP_010696270.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X2 [Beta vulgaris subsp. vulgaris] gi|870844050|gb|KMS97109.1| hypothetical protein BVRB_7g178910 [Beta vulgaris subsp. vulgaris] Length = 249 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 2/54 (3%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGKP--QNNDWDGEQGRSGFSASED 169 RK KW +FLA+TRSAI SK+++R G +G P QN+DW+GE G GFSAS+D Sbjct: 191 RKLKWNEFLAMTRSAINSKRTRRGNVTG-KGAPSVQNSDWEGEHGVKGFSASDD 243 >ref|XP_010696269.1| PREDICTED: ethylene-responsive transcription factor-like protein At4g13040 isoform X1 [Beta vulgaris subsp. vulgaris] Length = 279 Score = 62.0 bits (149), Expect = 2e-07 Identities = 31/54 (57%), Positives = 40/54 (74%), Gaps = 2/54 (3%) Frame = -2 Query: 324 RKFKWEDFLAITRSAITSKKSQRRTGPGLRGKP--QNNDWDGEQGRSGFSASED 169 RK KW +FLA+TRSAI SK+++R G +G P QN+DW+GE G GFSAS+D Sbjct: 221 RKLKWNEFLAMTRSAINSKRTRRGNVTG-KGAPSVQNSDWEGEHGVKGFSASDD 273