BLASTX nr result
ID: Forsythia22_contig00035656
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00035656 (357 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_012446884.1| PREDICTED: protein DCL, chloroplastic-like [... 119 6e-25 gb|KHG12122.1| Protein DCL, chloroplastic [Gossypium arboreum] 119 6e-25 ref|NP_190247.1| uncharacterized protein [Arabidopsis thaliana] ... 119 8e-25 ref|XP_002877497.1| hypothetical protein ARALYDRAFT_905861 [Arab... 119 8e-25 ref|XP_011069724.1| PREDICTED: protein DCL, chloroplastic [Sesam... 119 1e-24 ref|XP_010426102.1| PREDICTED: protein DCL, chloroplastic-like [... 118 2e-24 ref|XP_010514986.1| PREDICTED: protein DCL, chloroplastic-like [... 118 2e-24 ref|XP_010503277.1| PREDICTED: protein DCL, chloroplastic-like [... 118 2e-24 ref|XP_009150243.1| PREDICTED: protein DCL, chloroplastic-like [... 118 2e-24 emb|CDY21779.1| BnaA06g20480D [Brassica napus] 118 2e-24 emb|CDY38070.1| BnaC03g75090D [Brassica napus] 118 2e-24 emb|CDP01288.1| unnamed protein product [Coffea canephora] 118 2e-24 ref|XP_006418877.1| hypothetical protein EUTSA_v10002669mg [Eutr... 118 2e-24 ref|XP_010540381.1| PREDICTED: protein DCL, chloroplastic-like [... 117 4e-24 gb|KFK33996.1| hypothetical protein AALP_AA5G088200 [Arabis alpina] 116 5e-24 ref|XP_007017144.1| Uncharacterized protein TCM_033766 [Theobrom... 116 5e-24 ref|XP_012068293.1| PREDICTED: protein DCL, chloroplastic-like [... 116 7e-24 ref|XP_010270909.1| PREDICTED: protein DCL, chloroplastic [Nelum... 115 9e-24 ref|XP_002283006.1| PREDICTED: protein DCL, chloroplastic isofor... 115 9e-24 ref|XP_008220273.1| PREDICTED: protein DCL, chloroplastic [Prunu... 115 1e-23 >ref|XP_012446884.1| PREDICTED: protein DCL, chloroplastic-like [Gossypium raimondii] gi|763791505|gb|KJB58501.1| hypothetical protein B456_009G215500 [Gossypium raimondii] Length = 197 Score = 119 bits (299), Expect = 6e-25 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAYIRDKYPSHAERFI+EHFKR Sbjct: 141 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPSHAERFIREHFKR 194 >gb|KHG12122.1| Protein DCL, chloroplastic [Gossypium arboreum] Length = 197 Score = 119 bits (299), Expect = 6e-25 Identities = 52/54 (96%), Positives = 54/54 (100%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAYIRDKYPSHAERFI+EHFKR Sbjct: 141 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPSHAERFIREHFKR 194 >ref|NP_190247.1| uncharacterized protein [Arabidopsis thaliana] gi|6523066|emb|CAB62333.1| putative protein [Arabidopsis thaliana] gi|21554240|gb|AAM63315.1| unknown [Arabidopsis thaliana] gi|26452933|dbj|BAC43543.1| unknown protein [Arabidopsis thaliana] gi|28973177|gb|AAO63913.1| unknown protein [Arabidopsis thaliana] gi|332644664|gb|AEE78185.1| uncharacterized protein AT3G46630 [Arabidopsis thaliana] Length = 207 Score = 119 bits (298), Expect = 8e-25 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAY+RDKYPSHAERFI+EHFKR Sbjct: 151 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDKYPSHAERFIREHFKR 204 >ref|XP_002877497.1| hypothetical protein ARALYDRAFT_905861 [Arabidopsis lyrata subsp. lyrata] gi|297323335|gb|EFH53756.1| hypothetical protein ARALYDRAFT_905861 [Arabidopsis lyrata subsp. lyrata] Length = 203 Score = 119 bits (298), Expect = 8e-25 Identities = 51/54 (94%), Positives = 54/54 (100%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAY+RDKYPSHAERFI+EHFKR Sbjct: 147 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDKYPSHAERFIREHFKR 200 >ref|XP_011069724.1| PREDICTED: protein DCL, chloroplastic [Sesamum indicum] Length = 200 Score = 119 bits (297), Expect = 1e-24 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAYIRDKYPSHAERFI EHFKR Sbjct: 144 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPSHAERFISEHFKR 197 >ref|XP_010426102.1| PREDICTED: protein DCL, chloroplastic-like [Camelina sativa] Length = 205 Score = 118 bits (295), Expect = 2e-24 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAY+RD+YPSHAERFI+EHFKR Sbjct: 149 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDRYPSHAERFIREHFKR 202 >ref|XP_010514986.1| PREDICTED: protein DCL, chloroplastic-like [Camelina sativa] Length = 199 Score = 118 bits (295), Expect = 2e-24 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAY+RD+YPSHAERFI+EHFKR Sbjct: 143 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDRYPSHAERFIREHFKR 196 >ref|XP_010503277.1| PREDICTED: protein DCL, chloroplastic-like [Camelina sativa] Length = 205 Score = 118 bits (295), Expect = 2e-24 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAY+RD+YPSHAERFI+EHFKR Sbjct: 149 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDRYPSHAERFIREHFKR 202 >ref|XP_009150243.1| PREDICTED: protein DCL, chloroplastic-like [Brassica rapa] Length = 193 Score = 118 bits (295), Expect = 2e-24 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAY+RD+YPSHAERFI+EHFKR Sbjct: 137 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDRYPSHAERFIREHFKR 190 >emb|CDY21779.1| BnaA06g20480D [Brassica napus] Length = 194 Score = 118 bits (295), Expect = 2e-24 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAY+RD+YPSHAERFI+EHFKR Sbjct: 138 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDRYPSHAERFIREHFKR 191 >emb|CDY38070.1| BnaC03g75090D [Brassica napus] Length = 199 Score = 118 bits (295), Expect = 2e-24 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAY+RD+YPSHAERFI+EHFKR Sbjct: 143 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDRYPSHAERFIREHFKR 196 >emb|CDP01288.1| unnamed protein product [Coffea canephora] Length = 201 Score = 118 bits (295), Expect = 2e-24 Identities = 52/54 (96%), Positives = 53/54 (98%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAYIRDKYPSHAERFIK HFKR Sbjct: 145 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPSHAERFIKGHFKR 198 >ref|XP_006418877.1| hypothetical protein EUTSA_v10002669mg [Eutrema salsugineum] gi|557096805|gb|ESQ37313.1| hypothetical protein EUTSA_v10002669mg [Eutrema salsugineum] Length = 202 Score = 118 bits (295), Expect = 2e-24 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAY+RD+YPSHAERFI+EHFKR Sbjct: 146 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDRYPSHAERFIREHFKR 199 >ref|XP_010540381.1| PREDICTED: protein DCL, chloroplastic-like [Tarenaya hassleriana] Length = 203 Score = 117 bits (292), Expect = 4e-24 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAY+RDKYPSHAERFI+EH KR Sbjct: 147 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDKYPSHAERFIREHLKR 200 >gb|KFK33996.1| hypothetical protein AALP_AA5G088200 [Arabis alpina] Length = 202 Score = 116 bits (291), Expect = 5e-24 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAY+RDKYPSHAERFI+E+FKR Sbjct: 146 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYVRDKYPSHAERFIRENFKR 199 >ref|XP_007017144.1| Uncharacterized protein TCM_033766 [Theobroma cacao] gi|508722472|gb|EOY14369.1| Uncharacterized protein TCM_033766 [Theobroma cacao] Length = 197 Score = 116 bits (291), Expect = 5e-24 Identities = 51/54 (94%), Positives = 53/54 (98%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAYIRDKYPSHAERFI +HFKR Sbjct: 141 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPSHAERFIGKHFKR 194 >ref|XP_012068293.1| PREDICTED: protein DCL, chloroplastic-like [Jatropha curcas] gi|643735017|gb|KDP41687.1| hypothetical protein JCGZ_16094 [Jatropha curcas] Length = 196 Score = 116 bits (290), Expect = 7e-24 Identities = 50/54 (92%), Positives = 54/54 (100%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAYIRDKYP++AERFI+EHFKR Sbjct: 140 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPTYAERFIREHFKR 193 >ref|XP_010270909.1| PREDICTED: protein DCL, chloroplastic [Nelumbo nucifera] Length = 210 Score = 115 bits (289), Expect = 9e-24 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+R YIR+KYPSHAERFI+EHFKR Sbjct: 154 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLREYIRNKYPSHAERFIREHFKR 207 >ref|XP_002283006.1| PREDICTED: protein DCL, chloroplastic isoform X1 [Vitis vinifera] gi|302142270|emb|CBI19473.3| unnamed protein product [Vitis vinifera] Length = 194 Score = 115 bits (289), Expect = 9e-24 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKC+RAYIRDKYPSHA+RFI+ HFKR Sbjct: 138 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCLRAYIRDKYPSHADRFIRVHFKR 191 >ref|XP_008220273.1| PREDICTED: protein DCL, chloroplastic [Prunus mume] Length = 207 Score = 115 bits (288), Expect = 1e-23 Identities = 50/54 (92%), Positives = 53/54 (98%) Frame = -3 Query: 355 MVDRHPQFRHSRCLFVVRTDGGWIDFSYQKCIRAYIRDKYPSHAERFIKEHFKR 194 MVDRHPQFRHSRCLFV+RTDG WIDFSYQKC+RAYIRDKYPSHAERFI+EHFKR Sbjct: 151 MVDRHPQFRHSRCLFVIRTDGIWIDFSYQKCLRAYIRDKYPSHAERFIREHFKR 204