BLASTX nr result
ID: Forsythia22_contig00034756
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Forsythia22_contig00034756 (373 letters) Database: ./nr 69,698,275 sequences; 24,982,196,650 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP14384.1| unnamed protein product [Coffea canephora] 59 1e-06 ref|XP_011082561.1| PREDICTED: periodic tryptophan protein 1 hom... 58 3e-06 ref|XP_012857625.1| PREDICTED: uncharacterized WD repeat-contain... 58 3e-06 ref|XP_008241733.1| PREDICTED: periodic tryptophan protein 1 hom... 57 6e-06 ref|XP_007201966.1| hypothetical protein PRUPE_ppa004723mg [Prun... 57 6e-06 >emb|CDP14384.1| unnamed protein product [Coffea canephora] Length = 193 Score = 58.9 bits (141), Expect = 1e-06 Identities = 27/33 (81%), Positives = 28/33 (84%) Frame = -2 Query: 99 LCPQVQAVAWNHFASQVLLSESFDHSVVMKDGR 1 +C QVQAVAWNHF QVLLS SFDHSVVMKD R Sbjct: 1 MCHQVQAVAWNHFVPQVLLSGSFDHSVVMKDAR 33 >ref|XP_011082561.1| PREDICTED: periodic tryptophan protein 1 homolog [Sesamum indicum] gi|747071391|ref|XP_011082562.1| PREDICTED: periodic tryptophan protein 1 homolog [Sesamum indicum] Length = 489 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 90 QVQAVAWNHFASQVLLSESFDHSVVMKDGR 1 +VQAVAWNHFA QVLLS SFDHSVVMKDGR Sbjct: 301 KVQAVAWNHFAPQVLLSGSFDHSVVMKDGR 330 >ref|XP_012857625.1| PREDICTED: uncharacterized WD repeat-containing protein C17D11.16-like [Erythranthe guttatus] gi|604300827|gb|EYU20577.1| hypothetical protein MIMGU_mgv1a005214mg [Erythranthe guttata] Length = 493 Score = 57.8 bits (138), Expect = 3e-06 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 90 QVQAVAWNHFASQVLLSESFDHSVVMKDGR 1 +VQAVAWNHFA QVLLS SFDHSVVMKDGR Sbjct: 302 KVQAVAWNHFAPQVLLSGSFDHSVVMKDGR 331 >ref|XP_008241733.1| PREDICTED: periodic tryptophan protein 1 homolog [Prunus mume] Length = 497 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 90 QVQAVAWNHFASQVLLSESFDHSVVMKDGR 1 +VQAVAWNHFA QVLLS SFDHSVV+KDGR Sbjct: 307 KVQAVAWNHFAHQVLLSGSFDHSVVLKDGR 336 >ref|XP_007201966.1| hypothetical protein PRUPE_ppa004723mg [Prunus persica] gi|462397497|gb|EMJ03165.1| hypothetical protein PRUPE_ppa004723mg [Prunus persica] Length = 494 Score = 56.6 bits (135), Expect = 6e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = -2 Query: 90 QVQAVAWNHFASQVLLSESFDHSVVMKDGR 1 +VQAVAWNHFA QVLLS SFDHSVV+KDGR Sbjct: 304 KVQAVAWNHFAHQVLLSGSFDHSVVLKDGR 333